Mouse SOX12 Monoclonal Antibody | anti-SOX12 antibody

SOX12 (SRY (Sex Determining Region Y)-Box 12, SOX22) (AP)

Cat. Num. AAA6162082

• Gene Names: SOX12; SOX22
• Applications: Western Blot
• Purity: Purified
• Synonyms: SOX12; Monoclonal Antibody; SOX12 (SRY (Sex Determining Region Y)-Box 12; SOX22) (AP); SRY (Sex Determining Region Y)-Box 12; SOX22; anti-SOX12 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4A7
• Specificity: Recognizes SOX12.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-SOX12 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SOX12 (NP_008874, 252aa-313aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SOX12 is 0.1 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of SOX12 expression in transfected 293T cell line by SOX12 monoclonal antibody (M08), clone 4A7.Lane 1: SOX12 transfected lysate (Predicted MW: 34.1 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-SOX12 antibody

Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. [provided by RefSeq]

Product Categories/Family for anti-SOX12 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 21264339
• NCBI GeneID: 6666
• NCBI Accession #: NP_008874
• NCBI GenBank Nucleotide #: NM_006943
• UniProt Accession #: O15370
• Molecular Weight: 34kDa
• NCBI Official Full Name: transcription factor SOX-12
• NCBI Official Synonym Full Names: SRY-box 12
• NCBI Official Symbol: SOX12
• NCBI Official Synonym Symbols: SOX22
• NCBI Protein Information: transcription factor SOX-12
• UniProt Protein Name: Transcription factor SOX-12
• Protein Family: Transcription factor
• UniProt Gene Name: SOX12
• UniProt Synonym Gene Names: SOX22
• UniProt Entry Name: SOX12_HUMAN

NCBI Description

Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains, and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. [provided by RefSeq, Jan 2013]

Uniprot Description

Function: Binds to the sequence 5'-AACAAT-3'

By similarity.

Subcellular location: Nucleus Ref.1.

Tissue specificity: Expressed most abundantly in the CNS. Also expressed in fetal brain and kidney and adult heart, pancreas, testis and ovary. Other tissues were only weakly positive. Ref.1

Sequence similarities: Contains 1 HMG box DNA-binding domain.

Sequence caution: The sequence AAB69627.1 differs from that shown. Reason: Frameshift at positions 135 and 201.