Mouse SOLH Monoclonal Antibody | anti-SOLH antibody

SOLH (Small Pptic lobes Homolog (Drosophila), CAPN15, MGC131491) (MaxLight 550)

Cat. Num. AAA6219342

• Gene Names: CAPN15; SOLH
• Applications: FLISA
• Purity: Purified
• Synonyms: SOLH; Monoclonal Antibody; SOLH (Small Pptic lobes Homolog (Drosophila); CAPN15; MGC131491) (MaxLight 550); Small Pptic lobes Homolog (Drosophila); MGC131491; anti-SOLH antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2H7
• Specificity: Recognizes SOLH.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

• Applicable Applications for anti-SOLH antibody: FLISA
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SOLH (NP_005623, 993aa-1086aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
• Conjugate: MaxLight550
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-SOLH antibody

This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development. [provided by RefSeq]

Product Categories/Family for anti-SOLH antibody

Antibodies; Calpain

NCBI and Uniprot Product Information

• NCBI GI #: 5032105
• NCBI GeneID: 6650
• NCBI Accession #: NP_005623
• NCBI GenBank Nucleotide #: NM_005632
• UniProt Accession #: O75808
• Molecular Weight: 117kDa
• NCBI Official Full Name: calpain-15
• NCBI Official Synonym Full Names: calpain 15
• NCBI Official Symbol: CAPN15
• NCBI Official Synonym Symbols: SOLH
• NCBI Protein Information: calpain-15
• UniProt Protein Name: Calpain-15
• UniProt Gene Name: CAPN15
• UniProt Synonym Gene Names: SOLH
• UniProt Entry Name: CAN15_HUMAN

NCBI Description

This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development. [provided by RefSeq, Jul 2008]