Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of SOHLH2 transfected lysate using SOHLH2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SOHLH2 rabbit polyclonal antibody.)

Mouse anti-Human SOHLH2 Monoclonal Antibody | anti-SOHLH2 antibody

SOHLH2 (Spermatogenesis- and Oogenesis-specific Basic Helix-loop-helix-containing Protein 2, TEB1, bHLHe81, SPATA28) (PE)

Gene Names
SOHLH2; TEB1; SOSF2; SPATA28; bHLHe81
Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SOHLH2; Monoclonal Antibody; SOHLH2 (Spermatogenesis- and Oogenesis-specific Basic Helix-loop-helix-containing Protein 2; TEB1; bHLHe81; SPATA28) (PE); anti-SOHLH2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E1
Specificity
Recognizes human TEB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SOHLH2 antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-226 from human TEB1 (AAH25383) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of SOHLH2 transfected lysate using SOHLH2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SOHLH2 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SOHLH2 transfected lysate using SOHLH2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SOHLH2 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SOHLH2 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SOHLH2 is 3ng/ml as a capture antibody.)
Product Categories/Family for anti-SOHLH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
56,199 Da
NCBI Official Full Name
Homo sapiens spermatogenesis and oogenesis specific basic helix-loop-helix 2, mRNA
NCBI Official Synonym Full Names
spermatogenesis and oogenesis specific basic helix-loop-helix 2
NCBI Official Symbol
SOHLH2
NCBI Official Synonym Symbols
TEB1; SOSF2; SPATA28; bHLHe81
NCBI Protein Information
spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2

NCBI Description

This gene encodes one of testis-specific transcription factors which are essential for spermatogenesis, oogenesis and folliculogenesis. This gene is located on chromosome 13. The proteins encoded by this gene and another testis-specific transcription factor, SOHLH1, can form heterodimers, in addition to homodimers. There is a read-through locus (GeneID: 100526761) that shares sequence identity with this gene and the upstream CCDC169 (GeneID: 728591). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]

Research Articles on SOHLH2

Similar Products

Product Notes

The SOHLH2 (Catalog #AAA6160674) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SOHLH2 (Spermatogenesis- and Oogenesis-specific Basic Helix-loop-helix-containing Protein 2, TEB1, bHLHe81, SPATA28) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOHLH2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SOHLH2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOHLH2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.