Mouse anti-Human SOCS3 Monoclonal Antibody | anti-SOCS3 antibody
SOCS3 (Suppressor of Cytokine Signaling 3, SOCS-3, ATOD4, Cytokine-inducible SH2 Protein 3, CIS3, CIS-3, Cish3, STAT-induced STAT inhibitor 3, SSI3, SSI-3) (MaxLight 750)
Gene Names
SOCS3; CIS3; SSI3; ATOD4; Cish3; SSI-3; SOCS-3
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SOCS3; Monoclonal Antibody; SOCS3 (Suppressor of Cytokine Signaling 3; SOCS-3; ATOD4; Cytokine-inducible SH2 Protein 3; CIS3; CIS-3; Cish3; STAT-induced STAT inhibitor 3; SSI3; SSI-3) (MaxLight 750); anti-SOCS3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1E4
Specificity
Recognizes human SOCS3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-SOCS3 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-226 from SOCS3 (AAH60858) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-SOCS3 antibody
References
1. Epigenetic silencing of SOCS3 identifies a subset of prostate cancer with an aggressive behavior. Pierconti F, Martini M, Pinto F, Cenci T, Capodimonti S, Calarco A, Bassi PF, Larocca LM.Prostate. 2010 Aug 17.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
24,770 Da
NCBI Official Full Name
Homo sapiens suppressor of cytokine signaling 3, mRNA
NCBI Official Synonym Full Names
suppressor of cytokine signaling 3
NCBI Official Symbol
SOCS3
NCBI Official Synonym Symbols
CIS3; SSI3; ATOD4; Cish3; SSI-3; SOCS-3
NCBI Protein Information
suppressor of cytokine signaling 3
Protein Family
NCBI Description
This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development. [provided by RefSeq, Jul 2008]
Research Articles on SOCS3
Similar Products
Product Notes
The SOCS3 (Catalog #AAA6235480) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SOCS3 (Suppressor of Cytokine Signaling 3, SOCS-3, ATOD4, Cytokine-inducible SH2 Protein 3, CIS3, CIS-3, Cish3, STAT-induced STAT inhibitor 3, SSI3, SSI-3) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOCS3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SOCS3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SOCS3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
