Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SMPDL3B is 0.03ng/ml using MBS632955 as a capture antibody.)

Mouse anti-Human SMPDL3B Monoclonal Antibody | anti-SMPDL3B antibody

SMPDL3B (Acid Sphingomyelinase-like Phosphodiesterase 3b, ASM-like Phosphodiesterase 3b, ASML3B) (MaxLight 650)

Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
SMPDL3B; Monoclonal Antibody; SMPDL3B (Acid Sphingomyelinase-like Phosphodiesterase 3b; ASM-like Phosphodiesterase 3b; ASML3B) (MaxLight 650); anti-SMPDL3B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
5E12
Specificity
Recognizes human SMPDL3B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
373
Applicable Applications for anti-SMPDL3B antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa274-372 from human SMPDL3B with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FFGHHHTDSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGLKCITTFPHSQLIHLPLTTEPQE
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SMPDL3B is 0.03ng/ml using MBS632955 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SMPDL3B is 0.03ng/ml using MBS632955 as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen using MBS632955 (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen using MBS632955 (37kD).)
Related Product Information for anti-SMPDL3B antibody
Located on chromosome 1, this gene encodes for acid sphingomyelinase like phosphodiesterase 3b precursor protein.
Product Categories/Family for anti-SMPDL3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
acid sphingomyelinase-like phosphodiesterase 3b isoform 2
UniProt Protein Name
Acid sphingomyelinase-like phosphodiesterase 3b
UniProt Gene Name
SMPDL3B
UniProt Synonym Gene Names
ASML3B
UniProt Entry Name
ASM3B_HUMAN

Uniprot Description

SMPDL3B: Belongs to the acid sphingomyelinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.4.-; Phosphodiesterase; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1p35.3

Cellular Component: extracellular space

Molecular Function: sphingomyelin phosphodiesterase activity; hydrolase activity, acting on glycosyl bonds

Biological Process: sphingomyelin catabolic process

Similar Products

Product Notes

The SMPDL3B smpdl3b (Catalog #AAA6220448) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMPDL3B (Acid Sphingomyelinase-like Phosphodiesterase 3b, ASM-like Phosphodiesterase 3b, ASML3B) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMPDL3B can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMPDL3B smpdl3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMPDL3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.