Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SMO is approximately 0.1ng/ml as a capture antibody.)

Mouse SMO Monoclonal Antibody | anti-SMO antibody

SMO (Smoothened Homolog (Drosophila), Gx, SMOH) (AP)

Gene Names
SMO; Gx; CRJS; SMOH; FZD11
Applications
ELISA
Purity
Purified
Synonyms
SMO; Monoclonal Antibody; SMO (Smoothened Homolog (Drosophila); Gx; SMOH) (AP); Smoothened Homolog (Drosophila); SMOH; anti-SMO antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B1
Specificity
Recognizes SMO.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
787
Applicable Applications for anti-SMO antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SMO (NP_005622, 56aa-155aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SMO is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SMO is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-SMO antibody
Mouse monoclonal antibody raised against a partial recombinant SMO.
Product Categories/Family for anti-SMO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
smoothened homolog
NCBI Official Synonym Full Names
smoothened, frizzled class receptor
NCBI Official Symbol
SMO
NCBI Official Synonym Symbols
Gx; CRJS; SMOH; FZD11
NCBI Protein Information
smoothened homolog
UniProt Protein Name
Smoothened homolog
Protein Family
UniProt Gene Name
SMO
UniProt Synonym Gene Names
SMOH; SMO
UniProt Entry Name
SMO_HUMAN

NCBI Description

The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein complex. [provided by RefSeq, Jul 2010]

Uniprot Description

SMO: G protein-coupled receptor that probably associates with the patched protein (PTCH) to transduce the hedgehog's proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO). Required for the accumulation of KIF7 and GLI3 in the cilia. Belongs to the G-protein coupled receptor Fz/Smo family.

Protein type: Membrane protein, multi-pass; Oncoprotein; GPCR, Fz/Smo family; Receptor, GPCR; Cell development/differentiation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q32.3

Cellular Component: Golgi apparatus; intracellular membrane-bound organelle; plasma membrane; integral to membrane; caveola

Molecular Function: G-protein coupled receptor activity; Wnt-protein binding; protein binding; Wnt receptor activity; patched binding; drug binding

Biological Process: developmental growth; central nervous system neuron differentiation; ventral midline determination; negative regulation of epithelial cell differentiation; skeletal muscle fiber development; cell fate specification; negative regulation of transcription from RNA polymerase II promoter; thalamus development; Wnt receptor signaling pathway through beta-catenin; anterior/posterior pattern formation; positive regulation of mesenchymal cell proliferation; positive regulation of smoothened signaling pathway; heart looping; vasculogenesis; activation of hh target transcription factor; neural crest cell migration; dorsoventral neural tube patterning; positive regulation of neuroblast proliferation; smoothened signaling pathway; hair follicle morphogenesis; protein stabilization; smoothened signaling pathway in regulation of granule cell precursor cell proliferation; in utero embryonic development; multicellular organism growth; smoothened signaling pathway in ventral spinal cord patterning; forebrain morphogenesis; negative regulation of hair follicle development; negative regulation of DNA binding; odontogenesis of dentine-containing teeth; osteoblast differentiation; G-protein coupled receptor protein signaling pathway; positive regulation of protein import into nucleus; cerebellar cortex morphogenesis; myoblast migration; midgut development; positive regulation of transcription from RNA polymerase II promoter; positive regulation of epithelial cell proliferation; negative regulation of apoptosis

Research Articles on SMO

Similar Products

Product Notes

The SMO smo (Catalog #AAA6163695) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SMO can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMO smo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMO, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.