Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (52.29kD).)

Mouse anti-Human SMNDC1 Monoclonal Antibody | anti-SMNDC1 antibody

SMNDC1 (Survival Motor Neuron Domain-containing Protein 1, 30kD Splicing Factor SMNrp, SMN-related Protein, SMNR, Survival of Motor Neuron-related-splicing Factor 30, SPF30) (FITC)

Gene Names
SMNDC1; SMNR; SPF30; TDRD16C
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMNDC1; Monoclonal Antibody; SMNDC1 (Survival Motor Neuron Domain-containing Protein 1; 30kD Splicing Factor SMNrp; SMN-related Protein; SMNR; Survival of Motor Neuron-related-splicing Factor 30; SPF30) (FITC); anti-SMNDC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B9
Specificity
Recognizes human SMNDC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SMNDC1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 6ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-238 from SMNDC1 (AAH11234) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (52.29kD).)

Western Blot (WB) (Western Blot detection against Immunogen (52.29kD).)

Western Blot (WB)

(SMNDC1 monoclonal antibody Western Blot analysis of SMNDC1 expression in Jurkat)

Western Blot (WB) (SMNDC1 monoclonal antibody Western Blot analysis of SMNDC1 expression in Jurkat)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SMNDC1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 6ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SMNDC1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 6ug/ml])
Product Categories/Family for anti-SMNDC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
26,711 Da
NCBI Official Full Name
Homo sapiens survival motor neuron domain containing 1, mRNA
NCBI Official Synonym Full Names
survival motor neuron domain containing 1
NCBI Official Symbol
SMNDC1
NCBI Official Synonym Symbols
SMNR; SPF30; TDRD16C
NCBI Protein Information
survival of motor neuron-related-splicing factor 30

NCBI Description

This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. [provided by RefSeq, Jul 2008]

Research Articles on SMNDC1

Similar Products

Product Notes

The SMNDC1 (Catalog #AAA6149784) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMNDC1 (Survival Motor Neuron Domain-containing Protein 1, 30kD Splicing Factor SMNrp, SMN-related Protein, SMNR, Survival of Motor Neuron-related-splicing Factor 30, SPF30) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMNDC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 6ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMNDC1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMNDC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.