Mouse SMARCD3 Monoclonal Antibody | anti-SMARCD3 antibody

SMARCD3 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of chromatin, Subfamily d, Member 3, BAF60C, CRACD3, MGC111010, Rsc6p) (PE)

Cat. Num. AAA6185674

• Gene Names: SMARCD3; Rsc6p; BAF60C; CRACD3
• Applications: Western Blot
• Purity: Purified
• Synonyms: SMARCD3; Monoclonal Antibody; SMARCD3 (SWI/SNF Related; Matrix Associated; Actin Dependent Regulator of chromatin; Subfamily d; Member 3; BAF60C; CRACD3; MGC111010; Rsc6p) (PE); SWI/SNF Related; Rsc6p; anti-SMARCD3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5F12
• Specificity: Recognizes SMARCD3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-SMARCD3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SMARCD3 (NP_001003801, 385aa-483aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SMARCD3 monoclonal antibody (M02), clone 5F12 Western Blot analysis of SMARCD3 expression in K-562 (Cat # L009V1).)

Testing Data

(Detection limit for recombinant GST tagged SMARCD3 is approximately 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(SMARCD3 monoclonal antibody (M02), clone 5F12. Western Blot analysis of SMARCD3 expression in NIH/3T3.)

Related Product Information for anti-SMARCD3 antibody

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq]

Product Categories/Family for anti-SMARCD3 antibody

Antibodies; Matrix Metalloproteinases

NCBI and Uniprot Product Information

• NCBI GI #: 51477702
• NCBI GeneID: 6604
• NCBI Accession #: NP_001003801
• NCBI GenBank Nucleotide #: NM_001003801
• UniProt Accession #: Q6STE5; Q2YD86; Q75MJ2; Q75MR8; Q92926; Q9BUH1; D3DX10
• Molecular Weight: 53,687 Da
• NCBI Official Full Name: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 isoform 2
• NCBI Official Synonym Full Names: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
• NCBI Official Symbol: SMARCD3
• NCBI Official Synonym Symbols: Rsc6p; BAF60C; CRACD3
• NCBI Protein Information: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3; 60 kDa BRG-1/Brm-associated factor subunit C; BRG1-associated factor 60C; SWI/SNF complex 60 kDa subunit C; SWI/SNF related, matrix associated, actin dependent
• UniProt Protein Name: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
• Protein Family: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily
• UniProt Gene Name: SMARCD3
• UniProt Synonym Gene Names: BAF60C; BAF60C
• UniProt Entry Name: SMRD3_HUMAN

Uniprot Description

SMARCD3: Plays a role in ATP dependent nucleosome remodeling by SMARCA4 containing complexes. Stimulates nuclear receptor mediated transcription. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron- specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post- mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. Belongs to the SMARCD family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 7q35-q36

Cellular Component: nucleoplasm; SWI/SNF complex; cytoplasm; nuclear chromatin; nucleus

Molecular Function: ligand-dependent nuclear receptor binding; protein binding; ligand-dependent nuclear receptor transcription coactivator activity; transcription coactivator activity; transcription factor binding; receptor binding; nuclear hormone receptor binding

Biological Process: regulation of transcription from RNA polymerase II promoter; chromatin remodeling; positive regulation of neuroblast proliferation; muscle cell differentiation; nucleosome disassembly; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; regulation of protein binding; cellular lipid metabolic process