Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human SMARCD3 Monoclonal Antibody | anti-SMARCD3 antibody

SMARCD3 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily D Member 3, 60kD BRG-1/Brm-associated Factor Subunit C, BRG1-associated Factor 60C, BAF60C, MGC111010) (Biotin)

Gene Names
SMARCD3; Rsc6p; BAF60C; CRACD3
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMARCD3; Monoclonal Antibody; SMARCD3 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily D Member 3; 60kD BRG-1/Brm-associated Factor Subunit C; BRG1-associated Factor 60C; BAF60C; MGC111010) (Biotin); anti-SMARCD3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G6
Specificity
Recognizes human SMARCD3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SMARCD3 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa385-484 from human SMARCD3 (NP_001003801) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(SMARCD3 monoclonal antibody, Western Blot analysis of SMARCD3 expression in K-562.)

Western Blot (WB) (SMARCD3 monoclonal antibody, Western Blot analysis of SMARCD3 expression in K-562.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SMARCD3 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SMARCD3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SMARCD3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SMARCD3 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SMARCD3 antibody
References
1. Massively parallel sequencing identifies the gene Megf8 with ENU-induced mutation causing heterotaxy. Zhang Z, Alpert D, Francis R, Chatterjee B, Yu Q, Tansey T, Sabol SL, Cui C, Bai Y, Koriabine M, Yoshinaga Y, Cheng JF, Chen F, Martin J, Schackwitz W, Gunn TM, Kramer KL, De Jong PJ, Pennacchio LA, Lo CW.Proc Natl Acad Sci U S A. 2009 Mar 3;106(9):3219-24. Epub 2009 Feb 13. 2.The core component of the mammalian SWI/SNF complex SMARCD3/BAF60c is a coactivator for the nuclear retinoic acid receptor. Flajollet S, Lefebvre B, Cudejko C, Staels B, Lefebvre P.Mol Cell Endocrinol. 2007 May 30;270(1-2):23-32. Epub 2007 Feb 15.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,687 Da
NCBI Official Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 isoform 2
NCBI Official Synonym Full Names
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
NCBI Official Symbol
SMARCD3
NCBI Official Synonym Symbols
Rsc6p; BAF60C; CRACD3
NCBI Protein Information
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3; 60 kDa BRG-1/Brm-associated factor subunit C; BRG1-associated factor 60C; SWI/SNF complex 60 kDa subunit C; SWI/SNF related, matrix associated, actin dependent
UniProt Protein Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
UniProt Gene Name
SMARCD3
UniProt Synonym Gene Names
BAF60C; BAF60C
UniProt Entry Name
SMRD3_HUMAN

Uniprot Description

SMARCD3: Plays a role in ATP dependent nucleosome remodeling by SMARCA4 containing complexes. Stimulates nuclear receptor mediated transcription. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron- specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post- mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. Belongs to the SMARCD family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 7q35-q36

Cellular Component: nucleoplasm; SWI/SNF complex; cytoplasm; nuclear chromatin; nucleus

Molecular Function: ligand-dependent nuclear receptor binding; protein binding; ligand-dependent nuclear receptor transcription coactivator activity; transcription coactivator activity; transcription factor binding; receptor binding; nuclear hormone receptor binding

Biological Process: regulation of transcription from RNA polymerase II promoter; chromatin remodeling; positive regulation of neuroblast proliferation; muscle cell differentiation; nucleosome disassembly; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; regulation of protein binding; cellular lipid metabolic process

Similar Products

Product Notes

The SMARCD3 smarcd3 (Catalog #AAA6144473) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMARCD3 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily D Member 3, 60kD BRG-1/Brm-associated Factor Subunit C, BRG1-associated Factor 60C, BAF60C, MGC111010) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMARCD3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMARCD3 smarcd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMARCD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.