Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SMARCA5 Monoclonal Antibody | anti-SMARCA5 antibody

SMARCA5 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 5, SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin A5, Sucrose Nonfermenting Protein 2 Homolog, hSNF2H, SNF2H, WCRF135) (MaxLight

Gene Names
SMARCA5; ISWI; SNF2H; hISWI; hSNF2H; WCRF135
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMARCA5; Monoclonal Antibody; SMARCA5 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 5; SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin A5; Sucrose Nonfermenting Protein 2 Homolog; hSNF2H; SNF2H; WCRF135) (MaxLight; EC=3.6.4.-; hISWI; ISWI; anti-SMARCA5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F4
Specificity
Recognizes human SMARCA5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-SMARCA5 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa59-148 from SMARCA5 (NP_003592) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTE*
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-SMARCA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
122kDa
NCBI Official Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
NCBI Official Synonym Full Names
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
NCBI Official Symbol
SMARCA5
NCBI Official Synonym Symbols
ISWI; SNF2H; hISWI; hSNF2H; WCRF135
NCBI Protein Information
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
UniProt Protein Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
UniProt Gene Name
SMARCA5
UniProt Synonym Gene Names
SNF2H; WCRF135; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5; hSNF2H
UniProt Entry Name
SMCA5_HUMAN

NCBI Description

The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. [provided by RefSeq, Jul 2008]

Research Articles on SMARCA5

Similar Products

Product Notes

The SMARCA5 smarca5 (Catalog #AAA6224753) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SMARCA5 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 5, SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin A5, Sucrose Nonfermenting Protein 2 Homolog, hSNF2H, SNF2H, WCRF135) (MaxLight reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMARCA5 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMARCA5 smarca5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMARCA5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.