Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse SMAD6 Monoclonal Antibody | anti-SMAD6 antibody

SMAD6 (SMAD Family Member 6, HsT17432, MADH6, MADH7) (MaxLight 550)

Gene Names
SMAD6; AOVD2; MADH6; MADH7; HsT17432
Applications
Western Blot
Purity
Purified
Synonyms
SMAD6; Monoclonal Antibody; SMAD6 (SMAD Family Member 6; HsT17432; MADH6; MADH7) (MaxLight 550); SMAD Family Member 6; MADH7; anti-SMAD6 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F8
Specificity
Recognizes SMAD6.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-SMAD6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SMAD6 (NP_005576, 285aa-384aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SMAD6 antibody
The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila 'mothers against decapentaplegic' (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SMAD6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
Mothers against decapentaplegic homolog 6
NCBI Official Synonym Full Names
SMAD family member 6
NCBI Official Symbol
SMAD6
NCBI Official Synonym Symbols
AOVD2; MADH6; MADH7; HsT17432
NCBI Protein Information
mothers against decapentaplegic homolog 6
UniProt Protein Name
Mothers against decapentaplegic homolog 6
UniProt Gene Name
SMAD6
UniProt Synonym Gene Names
MADH6; MAD homolog 6; Mothers against DPP homolog 6; SMAD 6; Smad6; hSMAD6
UniProt Entry Name
SMAD6_HUMAN

NCBI Description

The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila 'mothers against decapentaplegic' (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants have been found for this gene.[provided by RefSeq, Sep 2014]

Uniprot Description

SMAD6: Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit selectively BMP (bone morphogenetic proteins) signaling by competing with the co-SMAD SMAD4 for receptor-activated SMAD1. SMAD6 is an inhibitory SMAD (I-SMAD) or antagonistic SMAD. Binds to regulatory elements in target promoter regions. Interacts with NEDD4L. Interacts with WWP1. Interacts with RNF111 and AXIN1. Interacts with TGF-beta type I receptor superfamily members, SMAD1, HOXC8 and HOXC9. Interacts with STAMBP and PRKX. Ubiquitous in various organs, with higher levels in lung. Isoform B is up-regulated in diseased heart tissue. Belongs to the dwarfin/SMAD family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 15q22.31

Cellular Component: transcription factor complex; protein complex; cytoplasm; cytosol; nucleus

Molecular Function: identical protein binding; protein binding; ubiquitin protein ligase binding; metal ion binding; chromatin binding; transforming growth factor beta receptor, inhibitory cytoplasmic mediator activity; transcription factor activity

Biological Process: BMP signaling pathway; fat cell differentiation; negative regulation of cell proliferation; zygotic determination of dorsal/ventral axis; transcription, DNA-dependent; ureteric bud development; response to estrogen stimulus; transforming growth factor beta receptor signaling pathway; immune response; negative regulation of transforming growth factor beta receptor signaling pathway; cell-substrate adhesion; negative regulation of apoptosis; negative regulation of BMP signaling pathway

Disease: Aortic Valve Disease 2

Research Articles on SMAD6

Similar Products

Product Notes

The SMAD6 smad6 (Catalog #AAA6219277) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SMAD6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAD6 smad6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.