Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SMAD1 monoclonal antibody (M06), clone 1B8 Western Blot analysis of SMAD1 expression in HeLa (Cat # L013V1).)

Mouse SMAD1 Monoclonal Antibody | anti-SMAD1 antibody

SMAD1 (SMAD Family Member 1, BSP1, JV4-1, JV41, MADH1, MADR1) (HRP)

Gene Names
SMAD1; BSP1; JV41; BSP-1; JV4-1; MADH1; MADR1
Applications
Western Blot
Purity
Purified
Synonyms
SMAD1; Monoclonal Antibody; SMAD1 (SMAD Family Member 1; BSP1; JV4-1; JV41; MADH1; MADR1) (HRP); SMAD Family Member 1; MADR1; anti-SMAD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B8
Specificity
Recognizes SMAD1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SMAD1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SMAD1 (AAH01878.1, 1aa-465aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SMAD1 monoclonal antibody (M06), clone 1B8 Western Blot analysis of SMAD1 expression in HeLa (Cat # L013V1).)

Western Blot (WB) (SMAD1 monoclonal antibody (M06), clone 1B8 Western Blot analysis of SMAD1 expression in HeLa (Cat # L013V1).)

Western Blot (WB)

(SMAD1 monoclonal antibody (M06), clone 1B8. Western Blot analysis of SMAD1 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB) (SMAD1 monoclonal antibody (M06), clone 1B8. Western Blot analysis of SMAD1 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB)

(SMAD1 monoclonal antibody (M06), clone 1B8. Western Blot analysis of SMAD1 expression in PC-12 (Cat # L012V1).)

Western Blot (WB) (SMAD1 monoclonal antibody (M06), clone 1B8. Western Blot analysis of SMAD1 expression in PC-12 (Cat # L012V1).)

Western Blot (WB)

(SMAD1 monoclonal antibody (M06), clone 1B8. Western Blot analysis of SMAD1 expression in Raw 264.7 (Cat # L024V1).)

Western Blot (WB) (SMAD1 monoclonal antibody (M06), clone 1B8. Western Blot analysis of SMAD1 expression in Raw 264.7 (Cat # L024V1).)
Product Categories/Family for anti-SMAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
52,260 Da
NCBI Official Full Name
SMAD family member 1
NCBI Official Synonym Full Names
SMAD family member 1
NCBI Official Symbol
SMAD1
NCBI Official Synonym Symbols
BSP1; JV41; BSP-1; JV4-1; MADH1; MADR1
NCBI Protein Information
mothers against decapentaplegic homolog 1; MAD homolog 1; Mad-related protein 1; TGF-beta signaling protein 1; mothers against DPP homolog 1; SMAD, mothers against DPP homolog 1; MAD, mothers against decapentaplegic homolog 1; transforming growth factor-b

NCBI Description

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]

Research Articles on SMAD1

Similar Products

Product Notes

The SMAD1 (Catalog #AAA6181256) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SMAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAD1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.