Mouse anti-Human SLPI Monoclonal Antibody | anti-SLPI antibody

SLPI (Secretory Leukocyte Protease Inhibitor, ALK1, ALP, BLPI, HUSI, HUSI-I, WAP4, WFDC4 Four-disulfide Core Domain 4, Antileukoproteinase, Mucus Proteinase Inhibitor, Seminal Proteinase Inhibitor) (HRP)

Cat. Num. AAA6155064

• Gene Names: SLPI; ALP; MPI; ALK1; BLPI; HUSI; WAP4; WFDC4; HUSI-I
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLPI; Monoclonal Antibody; SLPI (Secretory Leukocyte Protease Inhibitor; ALK1; ALP; BLPI; HUSI; HUSI-I; WAP4; WFDC4 Four-disulfide Core Domain 4; Antileukoproteinase; Mucus Proteinase Inhibitor; Seminal Proteinase Inhibitor) (HRP); anti-SLPI antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3C6
• Specificity: Recognizes human SLPI.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SLPI antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa33-133 from human SLPI (NP_003055) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged SLPI is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-SLPI antibody

SLPI is a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes; the protein is also thought to have broad-spectrum anti-biotic activity.

Product Categories/Family for anti-SLPI antibody

Antibodies; Protease Inhibitors

NCBI and Uniprot Product Information

• NCBI GI #: 4507065
• NCBI GeneID: 6590
• NCBI Accession #: NP_003055
• NCBI GenBank Nucleotide #: NM_003064
• UniProt Accession #: P03973; P07757; B2R5H8
• Molecular Weight: 14.0kDa (128aa) confirmed by MALDI-TOF
• NCBI Official Full Name: antileukoproteinase
• NCBI Official Synonym Full Names: secretory leukocyte peptidase inhibitor
• NCBI Official Symbol: SLPI
• NCBI Official Synonym Symbols: ALP; MPI; ALK1; BLPI; HUSI; WAP4; WFDC4; HUSI-I
• NCBI Protein Information: antileukoproteinase
• UniProt Protein Name: Antileukoproteinase
• Protein Family: Antileukoproteinase
• UniProt Gene Name: SLPI
• UniProt Synonym Gene Names: WAP4; WFDC4; ALP; MPI
• UniProt Entry Name: SLPI_HUMAN

NCBI Description

This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes. This antimicrobial protein has antibacterial, antifungal and antiviral activity. [provided by RefSeq, Nov 2014]

Uniprot Description

SLPI: Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. May prevent elastase-mediated damage to oral and possibly other mucosal tissues.

Protein type: Secreted; Inhibitor; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20q12

Cellular Component: extracellular matrix

Molecular Function: serine-type endopeptidase inhibitor activity; protein binding; enzyme binding; endopeptidase inhibitor activity

Biological Process: negative regulation of viral genome replication; negative regulation of protein binding