Mouse anti-Human SLK Monoclonal Antibody | anti-SLK antibody

SLK (STE20-like Serine/threonine-protein Kinase, STE20-like Kinase, hSLK, CTCL Tumor Antigen Se20-9, KIAA0204, STE20-related Serine/threonine-protein Kinase, STE20-related Kinase, Serine/threonine-protein Kinase 2, STK2) (HRP)

Cat. Num. AAA6155062

• Gene Names: SLK; LOSK; STK2; se20-9; bA16H23.1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLK; Monoclonal Antibody; SLK (STE20-like Serine/threonine-protein Kinase; STE20-like Kinase; hSLK; CTCL Tumor Antigen Se20-9; KIAA0204; STE20-related Serine/threonine-protein Kinase; STE20-related Kinase; Serine/threonine-protein Kinase 2; STK2) (HRP); EC=2.7.11.1; bA16H23.1; LOSK; se20-9; anti-SLK antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3E9
• Specificity: Recognizes human SLK.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 7827

• Applicable Applications for anti-SLK antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1126-1235 from SLK (NP_055535) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLEEEFARKLQEQEVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(SLK monoclonal antibody Western Blot analysis of SLK expression in Hela NE)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SLK on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Product Categories/Family for anti-SLK antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 1519245050
• NCBI GeneID: 9748
• NCBI Accession #: NM_014720.4
• NCBI GenBank Nucleotide #: NM_014720
• UniProt Accession #: Q9H2G2
• NCBI Official Full Name: Homo sapiens STE20 like kinase (SLK), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: STE20 like kinase
• NCBI Official Symbol: SLK
• NCBI Official Synonym Symbols: LOSK; STK2; se20-9; bA16H23.1
• NCBI Protein Information: STE20-like serine/threonine-protein kinase
• UniProt Protein Name: STE20-like serine/threonine-protein kinase
• Protein Family: STE20-like serine/threonine-protein kinase
• UniProt Gene Name: SLK
• UniProt Synonym Gene Names: KIAA0204; STK2; STE20-like kinase; hSLK
• UniProt Entry Name: SLK_HUMAN

Uniprot Description

SLK: a microtubule-associated protein kinase required for progression through G2. Co-localizes with the mitotic spindle in cells undergoing mitosis. Regulates actin reorganization during cell adhesion and spreading via a Rac1-mediated pathway. Signals via ASK1 and p38 to promote apoptosis. Activated in response to anoxia and ischemia-reperfusion injury in cell culture. It inhibits the protective aspects of the endoplasmic reticulum stress response, thus contributing to its proapoptotic effect. Two alternatively-spliced isoforms have been described.

Protein type: Protein kinase, STE; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; STE group; STE20 family; SLK subfamily

Chromosomal Location of Human Ortholog: 10q24.33

Cellular Component: cytoplasm

Molecular Function: protein serine/threonine kinase activity; identical protein binding; protein homodimerization activity; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: apoptosis; protein amino acid autophosphorylation