Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SLIT3 Monoclonal Antibody | anti-SLIT3 antibody

SLIT3 (Slit Homolog 3 Protein, Slit-3, Multiple Epidermal Growth Factor-like Domains Protein 5, Multiple EGF-like Domains Protein 5, KIAA0814, MEGF5, SLIL2, UNQ691/PRO1336, FLJ10764) (MaxLight 650)

Gene Names
SLIT3; MEGF5; SLIL2; SLIT1; slit2; Slit-3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLIT3; Monoclonal Antibody; SLIT3 (Slit Homolog 3 Protein; Slit-3; Multiple Epidermal Growth Factor-like Domains Protein 5; Multiple EGF-like Domains Protein 5; KIAA0814; MEGF5; SLIL2; UNQ691/PRO1336; FLJ10764) (MaxLight 650); anti-SLIT3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C5
Specificity
Recognizes human SLIT3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-SLIT3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1371-1471 from human SLIT3 (NP_003053) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA*
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SLIT3 antibody
May act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.
Product Categories/Family for anti-SLIT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
168kDa
NCBI Official Full Name
slit homolog 3 protein isoform 2
NCBI Official Synonym Full Names
slit guidance ligand 3
NCBI Official Symbol
SLIT3
NCBI Official Synonym Symbols
MEGF5; SLIL2; SLIT1; slit2; Slit-3
NCBI Protein Information
slit homolog 3 protein
UniProt Protein Name
Slit homolog 3 protein
Protein Family
UniProt Gene Name
SLIT3
UniProt Synonym Gene Names
KIAA0814; MEGF5; SLIL2; Slit-3
UniProt Entry Name
SLIT3_HUMAN

NCBI Description

The protein encoded by this gene is secreted, likely interacting with roundabout homolog receptors to effect cell migration. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]

Uniprot Description

SLIT3: May act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q35

Cellular Component: extracellular space; mitochondrion

Molecular Function: Roundabout binding; calcium ion binding

Biological Process: axon extension involved in axon guidance; chemorepulsion involved in embryonic olfactory bulb interneuron migration; axon guidance; negative regulation of cell proliferation; organ morphogenesis; response to cortisol stimulus; negative chemotaxis; negative regulation of cell growth; cellular response to hormone stimulus

Research Articles on SLIT3

Similar Products

Product Notes

The SLIT3 slit3 (Catalog #AAA6224738) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLIT3 (Slit Homolog 3 Protein, Slit-3, Multiple Epidermal Growth Factor-like Domains Protein 5, Multiple EGF-like Domains Protein 5, KIAA0814, MEGF5, SLIL2, UNQ691/PRO1336, FLJ10764) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLIT3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLIT3 slit3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLIT3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.