Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.59kD).)

Mouse anti-Human SLC9A6 Monoclonal Antibody | anti-SLC9A6 antibody

SLC9A6 (Solute Carrier Family 9 Member 6, KIAA0267, MRSA, Sodium/hydrogen Exchanger 6, Na(+)/H(+) Exchanger 6, NHE6, NHE-6) (AP)

Gene Names
SLC9A6; MRSA; NHE6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC9A6; Monoclonal Antibody; SLC9A6 (Solute Carrier Family 9 Member 6; KIAA0267; MRSA; Sodium/hydrogen Exchanger 6; Na(+)/H(+) Exchanger 6; NHE6; NHE-6) (AP); anti-SLC9A6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D5
Specificity
Recognizes human SLC9A6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
4623
Applicable Applications for anti-SLC9A6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa602-669 from SLC9A6 (NP_006350) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.59kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.59kD).)

Western Blot (WB)

(Western Blot analysis of SLC9A6 expression in transfected 293T cell line by SLC9A6 monoclonal antibody Lane 1: SLC9A6 transfected lysate (77.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SLC9A6 expression in transfected 293T cell line by SLC9A6 monoclonal antibody Lane 1: SLC9A6 transfected lysate (77.9kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SLC9A6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens solute carrier family 9 member A6 (SLC9A6), transcript variant 2, mRNA
NCBI Official Synonym Full Names
solute carrier family 9 member A6
NCBI Official Symbol
SLC9A6
NCBI Official Synonym Symbols
MRSA; NHE6
NCBI Protein Information
sodium/hydrogen exchanger 6
UniProt Protein Name
Sodium/hydrogen exchanger 6
UniProt Gene Name
SLC9A6
UniProt Synonym Gene Names
KIAA0267; NHE6; NHE-6
UniProt Entry Name
SL9A6_HUMAN

NCBI Description

This gene encodes a sodium-hydrogen exchanger that is amember of the solute carrier family 9. The encoded protein localizes to early and recycling endosomes and may be involved in regulating endosomal pH and volume. Defects in this gene are associated with X-linked syndromic cognitive disability, Christianson type. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Apr 2010]

Uniprot Description

NHE6: Electroneutral exchange of protons for Na(+) and K(+) across the early and recycling endosome membranes. Contributes to calcium homeostasis. Defects in SLC9A6 are the cause of mental retardation syndromic X-linked Christianson type (MRXSC); also known as MRXS-Christianson or X-linked Angelman-like syndrome. The phenotype is characterized by profound mental retardation, epilepsy, ataxia, and microcephaly, and showed phenotypic overlap with Angelman syndrome. Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Transporter, SLC family; Transporter; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq26.3

Cellular Component: endoplasmic reticulum membrane; mitochondrion; intracellular membrane-bound organelle; recycling endosome membrane; early endosome membrane; late endosome; dendrite; integral to membrane; plasma membrane; synapse; cytoplasmic vesicle; nerve terminal

Molecular Function: sodium:hydrogen antiporter activity

Biological Process: axon extension; transport; brain-derived neurotrophic factor receptor signaling pathway; synapse organization and biogenesis; regulation of pH; ion transport; regulation of nerve growth factor receptor signaling pathway; transmembrane transport; neurite morphogenesis

Disease: Mental Retardation, X-linked, Syndromic, Christianson Type

Research Articles on SLC9A6

Similar Products

Product Notes

The SLC9A6 slc9a6 (Catalog #AAA6133847) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC9A6 (Solute Carrier Family 9 Member 6, KIAA0267, MRSA, Sodium/hydrogen Exchanger 6, Na(+)/H(+) Exchanger 6, NHE6, NHE-6) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC9A6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC9A6 slc9a6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC9A6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.