Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SLC7A7 is ~0.1ng/ml as a capture antibody.)

Mouse anti-Human SLC7A7 Monoclonal Antibody | anti-SLC7A7 antibody

SLC7A7 (Solute Carrier Family 7 Member 7, Monocyte Amino Acid Permease 2, MOP-2, Y+L Amino Acid Transporter 1, y(+)L-type Amino Acid Transporter 1, Y+LAT1, y+LAT-1) (AP)

Gene Names
SLC7A7; LPI; LAT3; MOP-2; Y+LAT1; y+LAT-1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC7A7; Monoclonal Antibody; SLC7A7 (Solute Carrier Family 7 Member 7; Monocyte Amino Acid Permease 2; MOP-2; Y+L Amino Acid Transporter 1; y(+)L-type Amino Acid Transporter 1; Y+LAT1; y+LAT-1) (AP); LAT3; LPI; anti-SLC7A7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B10
Specificity
Recognizes human SLC7A7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
2082
Applicable Applications for anti-SLC7A7 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa462-512 from LC7A7 (NP_003973) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLC7A7 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC7A7 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-SLC7A7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens solute carrier family 7 member 7 (SLC7A7), transcript variant 1, mRNA
NCBI Official Synonym Full Names
solute carrier family 7 member 7
NCBI Official Symbol
SLC7A7
NCBI Official Synonym Symbols
LPI; LAT3; MOP-2; Y+LAT1; y+LAT-1
NCBI Protein Information
Y+L amino acid transporter 1
UniProt Protein Name
Y+L amino acid transporter 1
UniProt Gene Name
SLC7A7
UniProt Synonym Gene Names
MOP-2; Y+LAT1; y+LAT-1

NCBI Description

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2011]

Uniprot Description

Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Requires coexpression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Involved in the transport of L-arginine in monocytes.

Research Articles on SLC7A7

Similar Products

Product Notes

The SLC7A7 slc7a7 (Catalog #AAA6133844) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC7A7 (Solute Carrier Family 7 Member 7, Monocyte Amino Acid Permease 2, MOP-2, Y+L Amino Acid Transporter 1, y(+)L-type Amino Acid Transporter 1, Y+LAT1, y+LAT-1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC7A7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC7A7 slc7a7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC7A7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.