Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SLC39A13 Monoclonal Antibody | anti-SLC39A13 antibody

SLC39A13 (Solute Carrier Family 39 Member 13, LIV-1 Subfamily of ZIP Zinc Transporter 9, LZT-Hs9, Zinc Transporter ZIP13, Zrt- and Irt-like Protein 13, ZIP13, ZIP-13) APC

Gene Names
SLC39A13; ZIP13; SCDEDS; EDSSPD3; LZT-Hs9
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC39A13; Monoclonal Antibody; SLC39A13 (Solute Carrier Family 39 Member 13; LIV-1 Subfamily of ZIP Zinc Transporter 9; LZT-Hs9; Zinc Transporter ZIP13; Zrt- and Irt-like Protein 13; ZIP13; ZIP-13) APC; anti-SLC39A13 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G2
Specificity
Recognizes human SLC39A13.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
364
Applicable Applications for anti-SLC39A13 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa170-227 from human SLC39A13 (NP_689477) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LDSKEEGTSQAPNKDPTAAAAALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANT
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-SLC39A13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
zinc transporter ZIP13 isoform b
NCBI Official Synonym Full Names
solute carrier family 39 member 13
NCBI Official Symbol
SLC39A13
NCBI Official Synonym Symbols
ZIP13; SCDEDS; EDSSPD3; LZT-Hs9
NCBI Protein Information
zinc transporter ZIP13
UniProt Protein Name
Zinc transporter ZIP13
Protein Family
UniProt Gene Name
SLC39A13
UniProt Synonym Gene Names
ZIP13; LZT-Hs9; ZIP-13
UniProt Entry Name
S39AD_HUMAN

NCBI Description

This gene encodes a member of the LIV-1 subfamily of the ZIP transporter family. The encoded transmembrane protein functions as a zinc transporter. Mutations in this gene have been associated with the spondylocheiro dysplastic form of Ehlers-Danlos syndrome. Alternate transcript variants have been found for this gene. [provided by RefSeq, Jan 2016]

Uniprot Description

SLC39A13: Acts as a zinc-influx transporter. Defects in SLC39A13 are the cause of Ehlers-Danlos syndrome-like spondylocheirodysplasia (SCD-EDS). SCD- EDS is a 'spondylocheiro dysplastic form of Ehlers-Danlos syndrome'. The syndrome consists of a generalized skeletal dysplasia involving mainly the spine (spondylo) and striking clinical abnormalities of the hands (cheiro) in addition to the EDS-like features. Clinical features included postnatal growth retardation, moderate short stature, protuberant eyes with bluish sclerae, hands with finely wrinkled palms, atrophy of the thenar muscles, and tapering fingers. Patients have thin, hyperelastic skin and hypermobile small joints consistent with an Ehlers- Danlos-like phenotype. Radiologic features included mild to moderate platyspondyly, mild to moderate osteopenia of the spine, small ileum, flat proximal femoral epiphyses, short, wide femoral necks, and broad metaphyses (elbows, knees, wrists, and interphalangeal joints). Belongs to the ZIP transporter (TC 2.A.5) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; integral to membrane; integral to Golgi membrane

Molecular Function: protein homodimerization activity; zinc ion transmembrane transporter activity

Biological Process: cellular zinc ion homeostasis

Disease: Spondylocheirodysplasia, Ehlers-danlos Syndrome-like

Research Articles on SLC39A13

Similar Products

Product Notes

The SLC39A13 slc39a13 (Catalog #AAA6139131) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC39A13 (Solute Carrier Family 39 Member 13, LIV-1 Subfamily of ZIP Zinc Transporter 9, LZT-Hs9, Zinc Transporter ZIP13, Zrt- and Irt-like Protein 13, ZIP13, ZIP-13) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC39A13 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC39A13 slc39a13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC39A13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.