Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (39.09kD).)

Mouse anti-Human SLC30A5 Monoclonal Antibody | anti-SLC30A5 antibody

SLC30A5 (Solute Carrier Family 30 Member 5, Zinc Transporter 5, ZNT5, ZnT-5, ZnT-like Transporter 1, ZNTL1, ZTL1, hZTL1, UNQ863/PRO1879)

Gene Names
SLC30A5; ZNT5; ZTL1; ZNTL1; ZnT-5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLC30A5; Monoclonal Antibody; SLC30A5 (Solute Carrier Family 30 Member 5; Zinc Transporter 5; ZNT5; ZnT-5; ZnT-like Transporter 1; ZNTL1; ZTL1; hZTL1; UNQ863/PRO1879); Anti -SLC30A5 (Solute Carrier Family 30 Member 5; anti-SLC30A5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2F10-2B8
Specificity
Recognizes human SLC30A5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN
Applicable Applications for anti-SLC30A5 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-119 from human SLC30A5 (AAH00808) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (39.09kD).)

Western Blot (WB) (Western Blot detection against Immunogen (39.09kD).)
Product Categories/Family for anti-SLC30A5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
84,047 Da
NCBI Official Full Name
SLC30A5
NCBI Official Synonym Full Names
solute carrier family 30 (zinc transporter), member 5
NCBI Official Symbol
SLC30A5
NCBI Official Synonym Symbols
ZNT5; ZTL1; ZNTL1; ZnT-5
NCBI Protein Information
zinc transporter 5; zinc transporter ZTL1; znT-like transporter 1
UniProt Protein Name
Zinc transporter 5
Protein Family
UniProt Gene Name
SLC30A5
UniProt Synonym Gene Names
ZNT5; ZNTL1; ZTL1; ZnT-5; hZTL1
UniProt Entry Name
ZNT5_HUMAN

NCBI Description

This gene encodes a member of the SLC30A/ZnT family of zinc transporter proteins. ZnT proteins mediate both cellular zinc efflux and zinc sequestration into membrane-bound organelles. The encoded protein plays a role in the early secretory pathway as a heterodimer with zinc transporter 6, and may also regulate zinc sequestration into secretory granules of pancreatic beta cells. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 19. [provided by RefSeq, Oct 2011]

Uniprot Description

SLC30A5: Functions as a zinc transporter. May be a transporter of zinc into beta cells in order to form insulin crystals. Partly regulates cellular zinc homeostasis. Required with ZNT7 for the activation of zinc-requiring enzymes, alkaline phosphatases (ALPs). Transports zinc into the lumens of the Golgi apparatus and vesicular compartments where ALPs locate, thus, converting apoALPs to holoALPs. Required with ZNT6 and ZNT7 for the activation of TNAP. Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family. SLC30A subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Transporter, SLC family; Transporter; Membrane protein, integral

Chromosomal Location of Human Ortholog: 5q12.1

Cellular Component: Golgi apparatus; membrane; integral to plasma membrane; secretory granule membrane; apical plasma membrane; nucleolus; nucleus; secretory granule

Molecular Function: zinc ion binding; zinc ion transmembrane transporter activity

Biological Process: cellular protein metabolic process; response to zinc ion; cellular zinc ion homeostasis; regulation of proton transport; zinc ion transport; transmembrane transport; cobalt ion transport

Research Articles on SLC30A5

Similar Products

Product Notes

The SLC30A5 slc30a5 (Catalog #AAA6001665) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC30A5 (Solute Carrier Family 30 Member 5, Zinc Transporter 5, ZNT5, ZnT-5, ZnT-like Transporter 1, ZNTL1, ZTL1, hZTL1, UNQ863/PRO1879) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC30A5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SLC30A5 slc30a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEEKYGGDVL AGPGGGGGLG PVDVPSARLT KYIVLLCFTK FLKAVGLFES YDLLKAVHIV QFIFILKLGT AFFMVLFQKP FSSGKTITKH QIIGSLKIPG RKEFKDKKLN DPRKLVGN. It is sometimes possible for the material contained within the vial of "SLC30A5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.