Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.23kD).)

Mouse anti-Human SLC2A4RG Monoclonal Antibody | anti-SLC2A4RG antibody

SLC2A4RG (HDBP1, SLC2A4 Regulator, GLUT4 Enhancer Factor, Huntington Disease Gene Regulatory Region-binding Protein 1) (AP)

Gene Names
SLC2A4RG; GEF; HDBP1; HDBP-1; Si-1-2; Si-1-2-19
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC2A4RG; Monoclonal Antibody; SLC2A4RG (HDBP1; SLC2A4 Regulator; GLUT4 Enhancer Factor; Huntington Disease Gene Regulatory Region-binding Protein 1) (AP); anti-SLC2A4RG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C10
Specificity
Recognizes human SLC2A4RG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SLC2A4RG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa178-270 from human SLC2A4RG (NP_064446) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EAAHFLFGEPTLRKRKSPAQVMFQCLWKSCGKVLSTASAMQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPTASM
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.23kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.23kD).)

Western Blot (WB)

(SLC2A4RG monoclonal antibody, Western Blot analysis of SLC2A4RG expression in HeLa.)

Western Blot (WB) (SLC2A4RG monoclonal antibody, Western Blot analysis of SLC2A4RG expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SLC2A4RG on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SLC2A4RG on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-SLC2A4RG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
SLC2A4 regulator
NCBI Official Synonym Full Names
SLC2A4 regulator
NCBI Official Symbol
SLC2A4RG
NCBI Official Synonym Symbols
GEF; HDBP1; HDBP-1; Si-1-2; Si-1-2-19
NCBI Protein Information
SLC2A4 regulator
UniProt Protein Name
SLC2A4 regulator
Protein Family
UniProt Gene Name
SLC2A4RG
UniProt Synonym Gene Names
HDBP1; GEF; HDBP-1
UniProt Entry Name
S2A4R_HUMAN

NCBI Description

The protein encoded by this gene is a nuclear transcription factor involved in the activation of the solute carrier family 2 member 4 gene. The encoded protein interacts with another transcription factor, myocyte enhancer factor 2, to activate transcription of this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SLC2A4RG: Transcription factor involved in SLC2A4 and HD gene transactivation. Binds to the consensus sequence 5'-GCCGGCG-3'. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Research Articles on SLC2A4RG

Similar Products

Product Notes

The SLC2A4RG slc2a4rg (Catalog #AAA6133820) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC2A4RG (HDBP1, SLC2A4 Regulator, GLUT4 Enhancer Factor, Huntington Disease Gene Regulatory Region-binding Protein 1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC2A4RG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC2A4RG slc2a4rg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC2A4RG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.