Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human SLC25A25 Monoclonal Antibody | anti-SLC25A25 antibody

SLC25A25 (Calcium-binding Mitochondrial Carrier Protein SCaMC-2, Mitochondrial ATP-Mg/Pi Carrier Protein 3, Mitochondrial Ca(2+)-dependent Solute Carrier Protein 3, Small Calcium-binding Mitochondrial Carrier Protein 2, Solute Carrier Family 25 Member 25,

Gene Names
SLC25A25; MCSC; PCSCL; SCAMC-2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC25A25; Monoclonal Antibody; SLC25A25 (Calcium-binding Mitochondrial Carrier Protein SCaMC-2; Mitochondrial ATP-Mg/Pi Carrier Protein 3; Mitochondrial Ca(2+)-dependent Solute Carrier Protein 3; Small Calcium-binding Mitochondrial Carrier Protein 2; Solute Carrier Family 25 Member 25; ; anti-SLC25A25 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D8
Specificity
Recognizes human SLC25A25.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SLC25A25 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-111 from human SLC25A25 (NP_443133) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(Western Blot analysis of SLC25A25 expression in transfected 293T cell line by SLC25A25 monoclonal antibody. Lane 1: SLC25A25 transfected lysate (52.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SLC25A25 expression in transfected 293T cell line by SLC25A25 monoclonal antibody. Lane 1: SLC25A25 transfected lysate (52.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SLC25A25 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC25A25 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-SLC25A25 antibody
Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
Product Categories/Family for anti-SLC25A25 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53
NCBI Official Full Name
calcium-binding mitochondrial carrier protein SCaMC-2 isoform a
NCBI Official Synonym Full Names
solute carrier family 25 member 25
NCBI Official Symbol
SLC25A25
NCBI Official Synonym Symbols
MCSC; PCSCL; SCAMC-2
NCBI Protein Information
calcium-binding mitochondrial carrier protein SCaMC-2
UniProt Protein Name
Calcium-binding mitochondrial carrier protein SCaMC-2
UniProt Gene Name
SLC25A25
UniProt Synonym Gene Names
APC3; KIAA1896; MCSC3; SCAMC2
UniProt Entry Name
SCMC2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of calcium-binding mitochondrial carriers, with a characteristic mitochondrial carrier domain at the C-terminus. These proteins are found in the inner membranes of mitochondria, and function as transport proteins. They shuttle metabolites, nucleotides and cofactors through the mitochondrial membrane and thereby connect and/or regulate cytoplasm and matrix functions. This protein may function as an ATP-Mg/Pi carrier that mediates the transport of Mg-ATP in exchange for phosphate, and likely responsible for the net uptake or efflux of adenine nucleotides into or from the mitochondria. Alternatively spliced transcript variants encoding different isoforms with a common C-terminus but variable N-termini have been described for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

Function: Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. Ref.2

Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein Ref.1 Ref.2.

Tissue specificity: Present in various cell lines (at protein level). Widely expressed. Expressed in fetal and adult liver, skeletal muscle, testis, ovary, hippocampus and caudate nucleus. Isoform 1 is present in all tissues tested. Isoform 2 expression is restricted to kidney and lung. Ref.1 Ref.2

Sequence similarities: Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification]Contains 3 EF-hand domains.Contains 3 Solcar repeats.

Sequence caution: The sequence BAB67789.1 differs from that shown. Reason: Erroneous initiation. The sequence CAH73133.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI13826.1 differs from that shown. Reason: Erroneous gene model prediction.

Research Articles on SLC25A25

Similar Products

Product Notes

The SLC25A25 slc25a25 (Catalog #AAA6160320) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC25A25 (Calcium-binding Mitochondrial Carrier Protein SCaMC-2, Mitochondrial ATP-Mg/Pi Carrier Protein 3, Mitochondrial Ca(2+)-dependent Solute Carrier Protein 3, Small Calcium-binding Mitochondrial Carrier Protein 2, Solute Carrier Family 25 Member 25, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A25 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC25A25 slc25a25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC25A25, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.