Testing Data
(Detection limit for recombinant GST tagged SLC14A2 is ~1ng/ml as a capture antibody.)
Mouse anti-Human SLC14A2 Monoclonal Antibody | anti-SLC14A2 antibody
SLC14A2 (Solute Carrier Family 14 Member 2, Urea Transporter 2, UT2, HUT2, Urea Transporter, Kidney, UTA, UT-A2, hUT-A6, UTR) (AP)
Gene Names
SLC14A2; UT2; UTA; UTR; HUT2; UT-A2; hUT-A6
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC14A2; Monoclonal Antibody; SLC14A2 (Solute Carrier Family 14 Member 2; Urea Transporter 2; UT2; HUT2; Urea Transporter; Kidney; UTA; UT-A2; hUT-A6; UTR) (AP); anti-SLC14A2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E7
Specificity
Recognizes human SLC14A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
920
Applicable Applications for anti-SLC14A2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa40-129 from SLC14A2 (NP_009094) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged SLC14A2 is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SLC14A2 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-SLC14A2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
urea transporter 2
NCBI Official Synonym Full Names
solute carrier family 14 member 2
NCBI Official Symbol
SLC14A2
NCBI Official Synonym Symbols
UT2; UTA; UTR; HUT2; UT-A2; hUT-A6
NCBI Protein Information
urea transporter 2
UniProt Protein Name
Urea transporter 2
Protein Family
UniProt Gene Name
SLC14A2
UniProt Synonym Gene Names
HUT2; UT2
UniProt Entry Name
UT2_HUMAN
NCBI Description
The protein encoded by this gene belongs to the urea transporter family. In mammalian cells, urea is the chief end product of nitrogen catabolism, and plays an important role in the urinary concentration mechanism. This protein is expressed in the inner medulla of the kidney, and mediates rapid transepithelial urea transport across the inner medullary collecting duct. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2011]
Research Articles on SLC14A2
Similar Products
Product Notes
The SLC14A2 slc14a2 (Catalog #AAA6133782) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC14A2 (Solute Carrier Family 14 Member 2, Urea Transporter 2, UT2, HUT2, Urea Transporter, Kidney, UTA, UT-A2, hUT-A6, UTR) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC14A2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC14A2 slc14a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC14A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
