Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.02kD).)

Mouse anti-Human SLC13A3 Monoclonal Antibody | anti-SLC13A3 antibody

SLC13A3 (Solute Carrier Family 13 Member 3, Na(+)/dicarboxylate Cotransporter 3, NADC3, NaDC-3, hNaDC3, Sodium-dependent High-affinity Dicarboxylate Transporter 2, SDCT2)

Gene Names
SLC13A3; NADC3; SDCT2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLC13A3; Monoclonal Antibody; SLC13A3 (Solute Carrier Family 13 Member 3; Na(+)/dicarboxylate Cotransporter 3; NADC3; NaDC-3; hNaDC3; Sodium-dependent High-affinity Dicarboxylate Transporter 2; SDCT2); Anti -SLC13A3 (Solute Carrier Family 13 Member 3; anti-SLC13A3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A6
Specificity
Recognizes human SLC13A3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
LPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWK
Applicable Applications for anti-SLC13A3 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa152-233 from human SLC13A3 (NP_073740) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.02kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.02kD).)
Product Categories/Family for anti-SLC13A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
66,841 Da
NCBI Official Full Name
solute carrier family 13 member 3 isoform e
NCBI Official Synonym Full Names
solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3
NCBI Official Symbol
SLC13A3
NCBI Official Synonym Symbols
NADC3; SDCT2
NCBI Protein Information
solute carrier family 13 member 3; hNaDC3; naDC-3; Na(+)/dicarboxylate cotransporter 3; sodium-dependent high affinity dicarboxylate transporter 3; sodium-dependent high-affinity dicarboxylate transporter 2
UniProt Protein Name
Solute carrier family 13 member 3
Protein Family
UniProt Gene Name
SLC13A3
UniProt Synonym Gene Names
NADC3; SDCT2; NaDC-3; hNaDC3
UniProt Entry Name
S13A3_HUMAN

NCBI Description

Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet. [provided by RefSeq, Jul 2008]

Uniprot Description

SLC13A3: High-affinity sodium-dicarboxylate cotransporter that accepts a range of substrates with 4-5 carbon atoms. The stoichiometry is probably 3 Na(+) for 1 divalent succinate. Belongs to the SLC13A/DASS transporter (TC 2.A.47) family. NADC subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, SLC family

Chromosomal Location of Human Ortholog: 20q13.12

Cellular Component: plasma membrane; integral to membrane

Molecular Function: high affinity sodium:dicarboxylate symporter activity

Biological Process: dicarboxylic acid transport; sodium ion transport; transmembrane transport

Research Articles on SLC13A3

Similar Products

Product Notes

The SLC13A3 slc13a3 (Catalog #AAA6000623) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC13A3 (Solute Carrier Family 13 Member 3, Na(+)/dicarboxylate Cotransporter 3, NADC3, NaDC-3, hNaDC3, Sodium-dependent High-affinity Dicarboxylate Transporter 2, SDCT2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC13A3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SLC13A3 slc13a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LPIANAILKS LFGQKEVRKD PSQESEENTA AVRRNGLHTV PTEMQFLAST EAKDHPGETE VPLDLPADSR KEDEYRRNIW K. It is sometimes possible for the material contained within the vial of "SLC13A3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.