Mouse anti-Human Sirtuin 2 Monoclonal Antibody | anti-SIRT2 antibody

Sirtuin 2 (NAD-dependent Protein Deacetylase Sirtuin-2, SIRT2, Regulatory Protein SIR2 Homolog 2, SIR2-like Protein 2, SIR2L, SIR2L2) (HRP)

Cat. Num. AAA6154971

• Gene Names: SIRT2; SIR2; SIR2L; SIR2L2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Sirtuin 2; Monoclonal Antibody; Sirtuin 2 (NAD-dependent Protein Deacetylase Sirtuin-2; SIRT2; Regulatory Protein SIR2 Homolog 2; SIR2-like Protein 2; SIR2L; SIR2L2) (HRP); EC=3.5.1.-; anti-SIRT2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4B11
• Specificity: Recognizes human SIRT2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SIRT2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa128-227 from SIRT2 (AAH03012) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of SIRT2 expression in transfected 293T cell line by SIRT2 monoclonal antibody Lane 1: SIRT2 transfected lysate (39.5kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SIRT2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SIRT2 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of SIRT2 over-expressed 293 cell line, cotransfected with SIRT2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SIRT2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-SIRT2 antibody

Antibodies; Sirtuins

NCBI and Uniprot Product Information

• NCBI GI #: 12804306
• NCBI GeneID: 22933
• Molecular Weight: 35,654 Da
• NCBI Official Full Name: Homo sapiens sirtuin (silent mating type information regulation 2 homolog) 2 (S. cerevisiae), mRNA
• NCBI Official Synonym Full Names: sirtuin 2
• NCBI Official Symbol: SIRT2
• NCBI Official Synonym Symbols: SIR2; SIR2L; SIR2L2
• NCBI Protein Information: NAD-dependent protein deacetylase sirtuin-2
• Protein Family: NAD-dependent protein deacetylase

NCBI Description

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Several transcript variants are resulted from alternative splicing of this gene. [provided by RefSeq, Jul 2010]