Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Rat SHOX2 Monoclonal Antibody | anti-SHOX2 antibody

SHOX2 (Short Stature Homeobox Protein 2, Paired-related Homeobox Protein SHOT, Homeobox Protein Og12X, OG12X, SHOT) (MaxLight 550)

Gene Names
SHOX2; OG12; SHOT; OG12X
Reactivity
Human, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SHOX2; Monoclonal Antibody; SHOX2 (Short Stature Homeobox Protein 2; Paired-related Homeobox Protein SHOT; Homeobox Protein Og12X; OG12X; SHOT) (MaxLight 550); anti-SHOX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D1
Specificity
Recognizes human SHOX2. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-SHOX2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa117-205 from human SHOX2 (NP_006875) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SHOX2 antibody
May be a growth regulator and have a role in specifying neural systems involved in processing somatosensory information, as well as in face and body structure formation.
Product Categories/Family for anti-SHOX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
short stature homeobox protein 2 isoform a
NCBI Official Synonym Full Names
short stature homeobox 2
NCBI Official Symbol
SHOX2
NCBI Official Synonym Symbols
OG12; SHOT; OG12X
NCBI Protein Information
short stature homeobox protein 2
UniProt Protein Name
Short stature homeobox protein 2
UniProt Gene Name
SHOX2
UniProt Synonym Gene Names
OG12X; SHOT
UniProt Entry Name
SHOX2_HUMAN

NCBI Description

This gene is a member of the homeobox family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeobox genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeobox genes. This locus represents a pseudoautosomal homeobox gene that is thought to be responsible for idiopathic short stature, and it is implicated in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009]

Uniprot Description

SHOX2: May be a growth regulator and have a role in specifying neural systems involved in processing somatosensory information, as well as in face and body structure formation. Belongs to the paired homeobox family. Bicoid subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 3q25.32

Cellular Component: nucleoplasm; nuclear membrane; mitochondrion

Molecular Function: sequence-specific DNA binding

Biological Process: embryonic forelimb morphogenesis; nervous system development; heart development; negative regulation of transcription from RNA polymerase II promoter; chondrocyte development; osteoblast differentiation; positive regulation of skeletal muscle fiber development; embryonic digestive tract morphogenesis; positive regulation of mesenchymal cell proliferation; positive regulation of smoothened signaling pathway; positive regulation of axonogenesis; positive regulation of transcription from RNA polymerase II promoter; regulation of chondrocyte differentiation; skeletal development

Research Articles on SHOX2

Similar Products

Product Notes

The SHOX2 shox2 (Catalog #AAA6213960) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SHOX2 (Short Stature Homeobox Protein 2, Paired-related Homeobox Protein SHOT, Homeobox Protein Og12X, OG12X, SHOT) (MaxLight 550) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SHOX2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SHOX2 shox2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SHOX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.