Mouse anti-Human SHISA5 Monoclonal Antibody | anti-SHISA5 antibody

SHISA5 (Protein Shisa-5, PSEC0133, Putative NF-kappa-B-activating Protein 120, Scotin, SCOTIN)

Cat. Num. AAA6012778

• Gene Names: SHISA5; SCOTIN
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: SHISA5; Monoclonal Antibody; SHISA5 (Protein Shisa-5; PSEC0133; Putative NF-kappa-B-activating Protein 120; Scotin; SCOTIN); Anti -SHISA5 (Protein Shisa-5; anti-SHISA5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G5
• Specificity: Recognizes human SCOTIN.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGFGATLAVGLTIFVLSVVTIIICFTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTMPPQPGMPAAPYPMQYPPPYPAQPMGPPAYHETLAGGAAAPYPASQPPYNPAYMDAPKAAL

• Applicable Applications for anti-SHISA5 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-138 from human SCOTIN (AAH01463) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (40.81kD).)

Product Categories/Family for anti-SHISA5 antibody

Antibodies; Abs to Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 33876247
• NCBI GeneID: 51246
• UniProt Accession #: Q8N114; Q69YY9; Q7Z433; Q8NHL9; Q96MW8; Q9BV58; B3KW99
• Molecular Weight: 25,582 Da
• NCBI Official Full Name: SHISA5 protein
• NCBI Official Synonym Full Names: shisa family member 5
• NCBI Official Symbol: SHISA5
• NCBI Official Synonym Symbols: SCOTIN
• NCBI Protein Information: protein shisa-5; shisa homolog 5; putative NF-kappa-B-activating protein 120
• UniProt Protein Name: Protein shisa-5
• Protein Family: Protein shisa
• UniProt Gene Name: SHISA5
• UniProt Synonym Gene Names: SCOTIN
• UniProt Entry Name: SHSA5_HUMAN

NCBI Description

This gene encodes a member of the shisa family. The encoded protein is localized to the endoplasmic reticulum, and together with p53 induces apoptosis in a caspase-dependent manner. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]

Uniprot Description

SCOTIN: Can induce apoptosis in a caspase-dependent manner and plays a role in p53/TP53-dependent apoptosis. Belongs to the shisa family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Apoptosis

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: endoplasmic reticulum membrane; nuclear membrane; integral to membrane

Molecular Function: signal transducer activity; protein binding; WW domain binding

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis