Mouse anti-Human SHIP2 Monoclonal Antibody | anti-SHIP2 antibody

SHIP2 (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2, SH2 Domain-containing Inositol-5'-phosphatase 2, SH2 Domain-containing Inositol Phosphatase 2, SHIP-2, Inositol Polyphosphate Phosphatase-like Protein 1, INPPL-1, Protein 51C, INPPL1) (MaxLi

Cat. Num. AAA6192608

• Gene Names: INPPL1; OPSMD; SHIP2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SHIP2; Monoclonal Antibody; SHIP2 (Phosphatidylinositol-3; 4; 5-trisphosphate 5-phosphatase 2; SH2 Domain-containing Inositol-5'-phosphatase 2; SH2 Domain-containing Inositol Phosphatase 2; SHIP-2; Inositol Polyphosphate Phosphatase-like Protein 1; INPPL-1; Protein 51C; INPPL1) (MaxLi; anti-SHIP2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3E6
• Specificity: Recognizes human INPPL1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
• Sequence Length: 1258

• Applicable Applications for anti-SHIP2 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1159-1258 from human INPPL1 (NP_001558) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
• Conjugate: MaxLight405
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-SHIP2 antibody

SHIP2 (inositol polyphosphate-5 phosphatase-like 1), contains a phosphatase domain and an SH2 (src-homology domain 2) motif. SHIP2 iswidely expressed in fibroblast and nonhematopoietic tumor cell lines. Tyrosine phosphorylation of SHIP2 occurrs in response to treatment of cells with EGF, platelet-derived growth factor (PDGF), nerve growth factor (NGF), insulin-like growth factor-1 (IGF1), or insulin. EGF and PDGF induces transient tyrosine phosphorylation of SHIP2, while treatment of cells with NGF, IGF1, or insulin results in prolonged tyrosine phosphorylation of SHIP2, indicaating that SHIP2 may play a significant role in regulation of phosphatidylinositol 3-prime-kinase signaling by growth factors and insulin. Some animal models indicate that SHIP2 is a potent negative regulator of insulin signaling and insulin sensitivity in vivo, while others suggest that SHIP2 mediates obesity resistance but not changes in glucose and insulin homeostasis.

Product Categories/Family for anti-SHIP2 antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 222136583
• NCBI GeneID: 3636
• NCBI Accession #: NP_001558
• NCBI GenBank Nucleotide #: NM_001567
• UniProt Accession #: O15357
• NCBI Official Full Name: phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
• NCBI Official Synonym Full Names: inositol polyphosphate phosphatase like 1
• NCBI Official Symbol: INPPL1
• NCBI Official Synonym Symbols: OPSMD; SHIP2
• NCBI Protein Information: phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
• UniProt Protein Name: Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
• UniProt Gene Name: INPPL1
• UniProt Synonym Gene Names: SHIP2; INPPL-1; SH2 domain-containing inositol phosphatase 2; SHIP-2
• UniProt Entry Name: SHIP2_HUMAN

NCBI Description

The protein encoded by this gene is an SH2-containing 5'-inositol phosphatase that is involved in the regulation of insulin function. The encoded protein also plays a role in the regulation of epidermal growth factor receptor turnover and actin remodelling. Additionally, this gene supports metastatic growth in breast cancer and is a valuable biomarker for breast cancer. [provided by RefSeq, Jan 2009]

Uniprot Description

SHIP-2: an SH2-containing inositol phosphatase. Recruited to activated receptor complexes including insulin R, PDGFR and Fc-gamma-R.

Protein type: Carbohydrate Metabolism - inositol phosphate; Phosphatase, lipid; Motility/polarity/chemotaxis; EC 3.1.3.86

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: Golgi apparatus; cytoskeleton; lamellipodium; cytoplasm; plasma membrane; cytosol; filopodium

Molecular Function: protein binding; hydrolase activity; SH2 domain binding; actin binding; SH3 domain binding

Biological Process: inositol phosphate metabolic process; immune system process; actin filament organization; glucose metabolic process; endocytosis; response to insulin stimulus; post-embryonic development; negative regulation of cell proliferation; phospholipid metabolic process; phosphatidylinositol biosynthetic process; phosphoinositide dephosphorylation; cell adhesion; endochondral ossification

Disease: Opsismodysplasia