Mouse SH3KBP1 Monoclonal Antibody | anti-SH3KBP1 antibody

SH3KBP1 (SH3-Domain Kinase Binding Protein 1, CIN85, GIG10, MIG18) (MaxLight 405)

Cat. Num. AAA6197834

• Gene Names: SH3KBP1; HSB1; CIN85; GIG10; HSB-1; MIG18; CD2BP3
• Applications: Western Blot
• Purity: Purified
• Synonyms: SH3KBP1; Monoclonal Antibody; SH3KBP1 (SH3-Domain Kinase Binding Protein 1; CIN85; GIG10; MIG18) (MaxLight 405); SH3-Domain Kinase Binding Protein 1; MIG18; anti-SH3KBP1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F11
• Specificity: Recognizes SH3KBP1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

• Applicable Applications for anti-SH3KBP1 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SH3KBP1 (NP_114098.1, 224aa-308aa) partial recombinant protein with GST tag.
• Immunogen Sequence: IKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWE
• Conjugate: MaxLight405
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-SH3KBP1 antibody

CBL (MIM 165360) constitutively interacts with SH3 domain-containing proteins and, upon tyrosine phosphorylation, with SH2 domain-containing proteins. The SH3KBP1 gene encodes an 85-kD CBL-interacting protein that enhances tumor necrosis factor (MIM 191160)-mediated apoptotic cell death (Narita et al., 2001 [PubMed 11474197]). [supplied by OMIM]

Product Categories/Family for anti-SH3KBP1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 13994242
• NCBI GeneID: 30011
• NCBI Accession #: NP_114098.1
• NCBI GenBank Nucleotide #: NM_031892.2
• UniProt Accession #: Q96B97; Q5JPT4; Q5JPT5; Q8IWX6; Q8IX98; Q96RN4; Q9NYR0; B7Z1D5
• Molecular Weight: 46,610 Da
• NCBI Official Full Name: SH3 domain-containing kinase-binding protein 1 isoform a
• NCBI Official Synonym Full Names: SH3-domain kinase binding protein 1
• NCBI Official Symbol: SH3KBP1
• NCBI Official Synonym Symbols: HSB1; CIN85; GIG10; HSB-1; MIG18; CD2BP3
• NCBI Protein Information: SH3 domain-containing kinase-binding protein 1; CD2-binding protein 3; c-Cbl-interacting protein; migration-inducing gene 18; cbl-interacting protein of 85 kDa; Src family kinase-binding protein 1; src-related kinase binding protein-1; human Src family ki
• UniProt Protein Name: SH3 domain-containing kinase-binding protein 1
• Protein Family: SH3KBP1-binding protein
• UniProt Gene Name: SH3KBP1
• UniProt Synonym Gene Names: CIN85; CD2BP3; HSB-1
• UniProt Entry Name: SH3K1_HUMAN

NCBI Description

This gene encodes an adapter protein that contains three N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

SH3KBP1: Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through a association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor. Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit. May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis. Can self-associate and form homotetramers. Interacts with CD2, F-actin capping protein, PIK3R3, GRB2, EGFR, MET, BLNK, MAP3K4, PDCD6IP, SPRY2, ARHGAP17, ARHGAP27, MAGI2, CRK, BCAR1, SOS1, ASAP1, ARAP3, HIP1R, SYNJ2, INPP5D and STAP1. Interacts with CBL and CBLB, but does not interact with CBLC. Two molecules of SH3KBP1 seem to bind through their respective SH3 1 domain to one molecule of CBLB. The interaction with CBL or CBLB and EGFR is increased upon EGF stimulation. The interaction with CBL is attenuated by PDCD6IP. Interacts through its proline-rich region with the SH3 domain of endophilins SH3GL1, SH3GL2 and SH3GL3. The SH3KBP1-endophilin complex seems to associate with a complex containing the phosphorylated receptor (EGFR or MET) and phosphorylated CBL. Probably associates with ASAP1 and phosphorylated EGFR. Probably part of a complex consisting of at least SH3KBP1, ASAP1 and ARAP3. Interacts with focal adhesion kinases PTK2 AND PTK2B, probably as a dimer. Interacts with DAB2 and probably associates with chathrin through its interaction with DAB2. Part of a complex consisting of SH3KBP1, DAB2, and clathrin heavy chain. DAB2 and clathrin dissociate from SH3KBP1 following growth factor treatment, enabling interaction with CBL. Interacts with DDN and probably associates with MAGI2 through its interaction with DDN. Interacts with the SH3 domains of SRC tyrosine-protein kinases SRC, LCK, LYN, FGR, FYN and HCK. Interacts with TRADD, BIRC2, TRAF1, TRAF2 and TNFR1, and the association with a TNFR1-associated complex upon stimulation with TNF-alpha seems to be mediated by SRC. Probably interacts with SH3KBP1. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: Xp22.1-p21.3

Cellular Component: neuron projection; cytoskeleton; cytoplasmic vesicle membrane; focal adhesion; plasma membrane; synapse; intercellular junction; cytosol

Molecular Function: protein binding; SH3 domain binding

Biological Process: epidermal growth factor receptor signaling pathway; negative regulation of epidermal growth factor receptor signaling pathway; regulation of cell shape; cell migration; cell-cell signaling; apoptosis; cytoskeleton organization and biogenesis; endocytosis