Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SH3GL1 is 3 ng/ml as a capture antibody.)

Mouse SH3GL1 Monoclonal Antibody | anti-SH3GL1 antibody

SH3GL1 (SH3-Domain GRB2-like 1, CNSA1, EEN, MGC111371, SH3D2B, SH3P8) (AP)

Gene Names
SH3GL1; EEN; CNSA1; SH3P8; SH3D2B
Applications
Western Blot
Purity
Purified
Synonyms
SH3GL1; Monoclonal Antibody; SH3GL1 (SH3-Domain GRB2-like 1; CNSA1; EEN; MGC111371; SH3D2B; SH3P8) (AP); SH3-Domain GRB2-like 1; SH3P8; anti-SH3GL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B5
Specificity
Recognizes SH3GL1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SH3GL1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SH3GL1 (NP_003016, 12aa-119aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SH3GL1 is 3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SH3GL1 is 3 ng/ml as a capture antibody.)

Western Blot (WB)

(SH3GL1 monoclonal antibody (M02), clone 2B5. Western Blot analysis of SH3GL1 expression in HeLa.)

Western Blot (WB) (SH3GL1 monoclonal antibody (M02), clone 2B5. Western Blot analysis of SH3GL1 expression in HeLa.)
Related Product Information for anti-SH3GL1 antibody
Mouse monoclonal antibody raised against a partial recombinant SH3GL1.
Product Categories/Family for anti-SH3GL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
endophilin-A2 isoform 1
NCBI Official Synonym Full Names
SH3 domain containing GRB2 like 1, endophilin A2
NCBI Official Symbol
SH3GL1
NCBI Official Synonym Symbols
EEN; CNSA1; SH3P8; SH3D2B
NCBI Protein Information
endophilin-A2
UniProt Protein Name
Endophilin-A2
Protein Family
UniProt Gene Name
SH3GL1
UniProt Synonym Gene Names
CNSA1; SH3D2B; EEN
UniProt Entry Name
SH3G1_HUMAN

NCBI Description

This gene encodes a member of the endophilin family of Src homology 3 domain-containing proteins. The encoded protein is involved in endocytosis and may also play a role in the cell cycle. Overexpression of this gene may play a role in leukemogenesis, and the encoded protein has been implicated in acute myeloid leukemia as a fusion partner of the myeloid-lymphoid leukemia protein. Pseudogenes of this gene are located on the long arm of chromosomes 11 and 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]

Research Articles on SH3GL1

Similar Products

Product Notes

The SH3GL1 sh3gl1 (Catalog #AAA6164310) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SH3GL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SH3GL1 sh3gl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SH3GL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.