Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.5kD).)

Mouse anti-Human SH2D3A Monoclonal Antibody | anti-SH2D3A antibody

SH2D3A (SH2 domain containing 3A, Novel SH2-containing Protein 1, NSP1, SH2 Domain-containing Protein 3A, UNQ175/PRO201) APC

Gene Names
SH2D3A; NSP1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SH2D3A; Monoclonal Antibody; SH2D3A (SH2 domain containing 3A; Novel SH2-containing Protein 1; NSP1; SH2 Domain-containing Protein 3A; UNQ175/PRO201) APC; anti-SH2D3A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B11
Specificity
Recognizes human SH2D3A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2281
Applicable Applications for anti-SH2D3A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa460-575 from SH2D3A (NP_005481) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPNPELREALTTGFVRRLLWGSRGAGAPRAERFEKFQRVLGVLSQRLEPD
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.5kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.5kD).)

Western Blot (WB)

(Western Blot analysis of SH2D3A expression in transfected 293T cell line by SH2D3A monoclonal antibody Lane 1: SH2D3A transfected lysate (63.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SH2D3A expression in transfected 293T cell line by SH2D3A monoclonal antibody Lane 1: SH2D3A transfected lysate (63.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SH2D3A is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SH2D3A is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-SH2D3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens SH2 domain containing 3A (SH2D3A), mRNA
NCBI Official Synonym Full Names
SH2 domain containing 3A
NCBI Official Symbol
SH2D3A
NCBI Official Synonym Symbols
NSP1
NCBI Protein Information
SH2 domain-containing protein 3A
UniProt Protein Name
SH2 domain-containing protein 3A
UniProt Gene Name
SH2D3A
UniProt Synonym Gene Names
NSP1
UniProt Entry Name
SH23A_HUMAN

Uniprot Description

SH2D3A: May play a role in JNK activation.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 19p13.3

Molecular Function: protein binding; SH3/SH2 adaptor activity; guanyl-nucleotide exchange factor activity

Biological Process: positive regulation of signal transduction; small GTPase mediated signal transduction; JNK cascade; positive regulation of GTPase activity

Research Articles on SH2D3A

Similar Products

Product Notes

The SH2D3A sh2d3a (Catalog #AAA6139028) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SH2D3A (SH2 domain containing 3A, Novel SH2-containing Protein 1, NSP1, SH2 Domain-containing Protein 3A, UNQ175/PRO201) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SH2D3A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SH2D3A sh2d3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SH2D3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.