<
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Mouse anti-Human SH2B1 Monoclonal Antibody | anti-SH2B1 antibody
SH2B1 (SH2B Adapter Protein 1, SH2B, KIAA1299, Pro-rich, PH and SH2 Domain-containing Signaling Mediator, PSM, SH2 Domain-containing Protein 1B) (AP)
Gene Names
SH2B1; PSM; SH2B
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SH2B1; Monoclonal Antibody; SH2B1 (SH2B Adapter Protein 1; SH2B; KIAA1299; Pro-rich; PH and SH2 Domain-containing Signaling Mediator; PSM; SH2 Domain-containing Protein 1B) (AP); anti-SH2B1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B9
Specificity
Recognizes human SH2B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SH2B1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa327-426 from human SH2B (AAH10704) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPFGASDCVTDHLP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot analysis of SH2B1 expression in transfected 293T cell line by SH2B1 monoclonal antibody. Lane 1: SH2B1 transfected lysate (52.917kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of SH2B1 expression in transfected 293T cell line by SH2B1 monoclonal antibody. Lane 1: SH2B1 transfected lysate (52.917kD). Lane 2: Non-transfected lysate.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SH2B1 on HeLa cell. [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SH2B1 on HeLa cell. [antibody concentration 10ug/ml])
Testing Data
(Detection limit for recombinant GST tagged SH2B is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SH2B is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-SH2B1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
72,188 Da
NCBI Official Full Name
Homo sapiens SH2B adaptor protein 1, mRNA
NCBI Official Synonym Full Names
SH2B adaptor protein 1
NCBI Official Symbol
SH2B1
NCBI Official Synonym Symbols
PSM; SH2B
NCBI Protein Information
SH2B adapter protein 1
Protein Family
NCBI Description
This gene encodes a member of the SH2-domain containing mediators family. The encoded protein mediates activation of various kinases and may function in cytokine and growth factor receptor signaling and cellular transformation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]
Research Articles on SH2B1
Similar Products
Product Notes
The SH2B1 (Catalog #AAA6133722) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SH2B1 (SH2B Adapter Protein 1, SH2B, KIAA1299, Pro-rich, PH and SH2 Domain-containing Signaling Mediator, PSM, SH2 Domain-containing Protein 1B) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SH2B1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SH2B1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SH2B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
