<
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])
Mouse SGK2 Monoclonal Antibody | anti-SGK2 antibody
SGK2 (Serum/Glucocorticoid Regulated Kinase 2, H-SGK2, dJ138B7.2) (AP)
Gene Names
SGK2; H-SGK2; dJ138B7.2
Applications
Western Blot
Purity
Purified
Synonyms
SGK2; Monoclonal Antibody; SGK2 (Serum/Glucocorticoid Regulated Kinase 2; H-SGK2; dJ138B7.2) (AP); Serum/Glucocorticoid Regulated Kinase 2; dJ138B7.2; anti-SGK2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
7C7
Specificity
Recognizes SGK2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
367
Applicable Applications for anti-SGK2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SGK2 (AAH65511, 293aa-367aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])
Western Blot (WB)
(SGK2 monoclonal antibody (M08), clone 7C7 Western Blot analysis of SGK2 expression in IMR-32.)
Western Blot (WB)
(SGK2 monoclonal antibody (M08), clone 7C7 Western Blot analysis of SGK2 expression in IMR-32.)
Testing Data
(Detection limit for recombinant GST tagged SGK2 is approximately 0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SGK2 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-SGK2 antibody
This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Two alternate transcripts encoding two different isoforms have been described. [provided by RefSeq]
Product Categories/Family for anti-SGK2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
SGK2 protein
NCBI Official Synonym Full Names
serum/glucocorticoid regulated kinase 2
NCBI Official Symbol
SGK2
NCBI Official Synonym Symbols
H-SGK2; dJ138B7.2
NCBI Protein Information
serine/threonine-protein kinase Sgk2
Protein Family
NCBI Description
This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
Research Articles on SGK2
Similar Products
Product Notes
The SGK2 (Catalog #AAA6162351) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SGK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SGK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SGK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
