Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse SGK2 Monoclonal Antibody | anti-SGK2 antibody

SGK2 (Serum/Glucocorticoid Regulated Kinase 2, H-SGK2, dJ138B7.2) (Biotin)

Gene Names
SGK2; H-SGK2; dJ138B7.2
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
SGK2; Monoclonal Antibody; SGK2 (Serum/Glucocorticoid Regulated Kinase 2; H-SGK2; dJ138B7.2) (Biotin); Serum/Glucocorticoid Regulated Kinase 2; dJ138B7.2; anti-SGK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
4G4
Specificity
Recognizes SGK2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
367
Applicable Applications for anti-SGK2 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SGK2 (AAH65511, 293aa-367aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Conjugate
Biotin
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(SGK2 monoclonal antibody (M05), clone 4G4. Western Blot analysis of SGK2 expression in Raw 264.7.)

Western Blot (WB) (SGK2 monoclonal antibody (M05), clone 4G4. Western Blot analysis of SGK2 expression in Raw 264.7.)

Western Blot (WB)

(SGK2 monoclonal antibody (M05), clone 4G4. Western Blot analysis of SGK2 expression in HepG2.)

Western Blot (WB) (SGK2 monoclonal antibody (M05), clone 4G4. Western Blot analysis of SGK2 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged SGK2 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SGK2 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-SGK2 antibody
This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK.
Product Categories/Family for anti-SGK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
SGK2 protein
NCBI Official Synonym Full Names
serum/glucocorticoid regulated kinase 2
NCBI Official Symbol
SGK2
NCBI Official Synonym Symbols
H-SGK2; dJ138B7.2
NCBI Protein Information
serine/threonine-protein kinase Sgk2

NCBI Description

This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]

Research Articles on SGK2

Similar Products

Product Notes

The SGK2 (Catalog #AAA6171190) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SGK2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SGK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SGK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.