Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human colon cancer. [antibody concentration 0.7 ug/ml])

Mouse SGK Monoclonal Antibody | anti-SGK antibody

SGK (Serum/Glucocorticoid Regulated Kinase 1, SGK) (AP)

Gene Names
SGK1; SGK
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
SGK; Monoclonal Antibody; SGK (Serum/Glucocorticoid Regulated Kinase 1; SGK) (AP); Serum/Glucocorticoid Regulated Kinase 1; anti-SGK antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C4
Specificity
Recognizes SGK.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
431
Applicable Applications for anti-SGK antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SGK (AAH01263, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human colon cancer. [antibody concentration 0.7 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human colon cancer. [antibody concentration 0.7 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human colon cancer. [antibody concentration 0.7 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human colon cancer. [antibody concentration 0.7 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SGK is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SGK is approximately 0.3ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SGK1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SGK1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SGK1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SGK1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-SGK antibody
This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq]
Product Categories/Family for anti-SGK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Serum/glucocorticoid regulated kinase 1
NCBI Official Synonym Full Names
serum/glucocorticoid regulated kinase 1
NCBI Official Symbol
SGK1
NCBI Official Synonym Symbols
SGK
NCBI Protein Information
serine/threonine-protein kinase Sgk1

NCBI Description

This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jan 2009]

Research Articles on SGK

Similar Products

Product Notes

The SGK (Catalog #AAA6161733) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SGK can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SGK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SGK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.