Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human SGCA Monoclonal Antibody | anti-SGCA antibody

SGCA (ADL, DAG2, Alpha-sarcoglycan, Alpha-SG, 50kD Dystrophin-associated Glycoprotein, 50DAG, Adhalin, Dystroglycan-2) (PE)

Gene Names
SGCA; A2; ADL; DAG2; DMDA2; 50-DAG; LGMD2D; SCARMD1; adhalin
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SGCA; Monoclonal Antibody; SGCA (ADL; DAG2; Alpha-sarcoglycan; Alpha-SG; 50kD Dystrophin-associated Glycoprotein; 50DAG; Adhalin; Dystroglycan-2) (PE); anti-SGCA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3C4
Specificity
Recognizes human SGCA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SGCA antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa26-133 from human SGCA (NM_000023, NP_000014.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLP
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(Western Blot analysis of SGCA expression in transfected 293T cell line using 133248. Lane 1: SGCA transfected lysate (42.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SGCA expression in transfected 293T cell line using 133248. Lane 1: SGCA transfected lysate (42.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SGCA is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SGCA is 1ng/ml as a capture antibody.)
Related Product Information for anti-SGCA antibody
This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SGCA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,875 Da
NCBI Official Full Name
alpha-sarcoglycan isoform 1
NCBI Official Synonym Full Names
sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein)
NCBI Official Symbol
SGCA
NCBI Official Synonym Symbols
A2; ADL; DAG2; DMDA2; 50-DAG; LGMD2D; SCARMD1; adhalin
NCBI Protein Information
alpha-sarcoglycan; 50DAG; 50kD DAG; alpha-SG; dystroglycan-2; 50 kDa dystrophin-associated glycoprotein
UniProt Protein Name
Alpha-sarcoglycan
Protein Family
UniProt Gene Name
SGCA
UniProt Synonym Gene Names
ADL; DAG2; Alpha-SG; 50DAG
UniProt Entry Name
SGCA_HUMAN

NCBI Description

This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

SGCA: Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix. Defects in SGCA are the cause of limb-girdle muscular dystrophy type 2D (LGMD2D); also known as Duchenne- like muscular dystrophy autosomal recessive type 2 or severe childhood autosomal recessive muscular dystrophy (SCARMD). LGMD2D is an autosomal recessive degenerative myopathy characterized by progressive muscle wasting from early childhood with loss of independent ambulation by teenage years. Muscle biopsy shows necrosis, decreased immunostaining for alpha sarcoglycan, and adhalin deficiency. The phenotype is less severe than LGMD2C. Belongs to the sarcoglycan alpha/epsilon family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: dystrophin-associated glycoprotein complex; cytoskeleton; cytoplasm; integral to membrane; sarcoglycan complex; intercellular junction; sarcolemma; lipid raft

Molecular Function: calcium ion binding

Biological Process: muscle development; muscle contraction

Disease: Muscular Dystrophy, Limb-girdle, Type 2d

Research Articles on SGCA

Similar Products

Product Notes

The SGCA sgca (Catalog #AAA6160229) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SGCA (ADL, DAG2, Alpha-sarcoglycan, Alpha-SG, 50kD Dystrophin-associated Glycoprotein, 50DAG, Adhalin, Dystroglycan-2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SGCA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SGCA sgca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SGCA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.