Mouse SFTPD Monoclonal Antibody | anti-SFTPD antibody

SFTPD (Surfactant Protein D, COLEC7, PSP-D, SFTP4, SP-D) (AP)

Cat. Num. AAA6163000

• Gene Names: SFTPD; SP-D; PSP-D; SFTP4; COLEC7
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: SFTPD; Monoclonal Antibody; SFTPD (Surfactant Protein D; COLEC7; PSP-D; SFTP4; SP-D) (AP); Surfactant Protein D; SP-D; anti-SFTPD antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A10
• Specificity: Recognizes SFTPD.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-SFTPD antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SFTPD (AAH22318.1, 21aa-375aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to SFTPD on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SFTPD on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml])

Related Product Information for anti-SFTPD antibody

Mouse monoclonal antibody raised against a full length recombinant SFTPD.

Product Categories/Family for anti-SFTPD antibody

Antibodies; Pulmonary Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 18490171
• NCBI GeneID: 6441
• UniProt Accession #: P35247; Q5T0M3; Q6FH08; Q86YK9; Q8TCD8; Q9UCJ2; Q9UCJ3
• Molecular Weight: 37,728 Da
• NCBI Official Full Name: Surfactant protein D
• NCBI Official Synonym Full Names: surfactant protein D
• NCBI Official Symbol: SFTPD
• NCBI Official Synonym Symbols: SP-D; PSP-D; SFTP4; COLEC7
• NCBI Protein Information: pulmonary surfactant-associated protein D; collectin 7; collectin-7; lung surfactant protein D; pulmonary surfactant apoprotein; surfactant, pulmonary-associated protein D; surfactant-associated protein, pulmonary 4
• UniProt Protein Name: Pulmonary surfactant-associated protein D
• Protein Family: Pulmonary surfactant-associated protein
• UniProt Gene Name: SFTPD
• UniProt Synonym Gene Names: COLEC7; PSPD; SFTP4; PSP-D; SP-D
• UniProt Entry Name: SFTPD_HUMAN

Uniprot Description

SFTPD: Contributes to the lung's defense against inhaled microorganisms. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties. Belongs to the SFTPD family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 10q22.2-q23.1

Cellular Component: extracellular space; proteinaceous extracellular matrix; collagen; lysosome; endocytic vesicle; extracellular region

Molecular Function: protein binding; carbohydrate binding

Biological Process: receptor-mediated endocytosis; negative regulation of T cell proliferation; positive regulation of phagocytosis; negative regulation of interleukin-2 biosynthetic process; defense response to bacterium; innate immune response; respiratory gaseous exchange; surfactant homeostasis; macrophage chemotaxis; alveolus development; regulation of cytokine production