Mouse anti-Human SERTAD1 Monoclonal Antibody | anti-Sertad1 antibody

SERTAD1 (SERTA Domain-containing Protein 1, CDK4-binding Protein p34SEI1, SEI1, SEI-1, Transcriptional Regulator Interacting with the PHD-bromodomain 1, TRIP-Br1)

Cat. Num. AAA647214

• Gene Names: Sertad1; Sei1; Sei-1; AV000455; AW456625; TRIP-Br1; 1110032C13Rik
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: SERTAD1; Monoclonal Antibody; SERTAD1 (SERTA Domain-containing Protein 1; CDK4-binding Protein p34SEI1; SEI1; SEI-1; Transcriptional Regulator Interacting with the PHD-bromodomain 1; TRIP-Br1); Anti -SERTAD1 (SERTA Domain-containing Protein 1; anti-Sertad1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H4
• Specificity: Recognizes human SERTAD1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSVLKLHHSPQQSEPDLRHLVLVVNTLRRIQASMAPAAALPPVPSPPAAPSVADNLLASSDAALSASMASLLEDLSHIEGLSQAPQPLADEGPPGRSIGGAAPSLGALDLLGPATGCLLDDGLEGLFEDIDTSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERPPGPGR*

• Applicable Applications for anti-Sertad1 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.; Dilution: ELISA: 1ng/ml
• Immunogen: Full-length recombinant corresponding to aa1-237 from human SERTAD1 (AAH02670) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (51.7kD).)

Testing Data

(Detection limit for recombinant GST tagged SERTAD1 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-Sertad1 antibody

Antibodies; Abs to Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 9055332
• NCBI GeneID: 55942
• NCBI Accession #: NP_061290.1
• NCBI GenBank Nucleotide #: NM_018820.4
• UniProt Accession #: Q9JL10; Q925E6; Q9D888
• Molecular Weight: 25,136 Da
• NCBI Official Full Name: SERTA domain-containing protein 1
• NCBI Official Synonym Full Names: SERTA domain containing 1
• NCBI Official Symbol: Sertad1
• NCBI Official Synonym Symbols: Sei1; Sei-1; AV000455; AW456625; TRIP-Br1; 1110032C13Rik
• NCBI Protein Information: SERTA domain-containing protein 1; p34SEI-1; CDK4-binding protein p34SEI1; PHD zinc finger- and bromodomain-interacting protein 1; transcriptional regulator interacting with the PHD-bromodomain 1
• UniProt Protein Name: SERTA domain-containing protein 1
• Protein Family: SERTA domain-containing protein
• UniProt Gene Name: Sertad1
• UniProt Synonym Gene Names: Sei1; SEI-1; TRIP-Br1
• UniProt Entry Name: SRTD1_MOUSE

Uniprot Description

Function: Acts at E2F-responsive promoters as coregulator to integrate signals provided by PHD- and/or bromodomain-containing transcription factors. Stimulates E2F1/TFDP1 transcriptional activity. Renders the activity of cyclin D1/CDK4 resistant to the inhibitory effects of CDKN2A/p16INK4A. Ref.2

Subunit structure: Interacts with the PHD-bromodomain of TIF1, TRIM28/TIF1B and p300/CBP. Interacts with E2F1 and TFDP1; modulates transactivation activity of TFDP1/E2F complexes. Also interacts with CDK4. Ref.2

Tissue specificity: Detected at in testis, lung and, at lower levels, in muscle, liver, spleen, brain and heart. Ref.2

Developmental stage: Detected as early as 7 dpc and persist until, at least, 17 dpc. Ref.2

Post-translational modification: Polyubiquitinated, which promotes proteasomal degradation

By similarity.

Sequence similarities: Contains 1 SERTA domain.