Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.76kD).)

Mouse anti-Human SERPINB3 Monoclonal Antibody | anti-SERPINB3 antibody

SERPINB3 (Serpin B3, Protein T4-A, Squamous Cell Carcinoma Antigen 1, SCCA-1, SCCA, SCCA1) APC

Gene Names
SERPINB3; SCC; T4-A; SCCA1; SSCA1; SCCA-1; HsT1196; SCCA-PD
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SERPINB3; Monoclonal Antibody; SERPINB3 (Serpin B3; Protein T4-A; Squamous Cell Carcinoma Antigen 1; SCCA-1; SCCA; SCCA1) APC; anti-SERPINB3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F5
Specificity
Recognizes human SERPINB3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SERPINB3 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa276-391 from human SERPINB3 (NP_008850) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.76kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.76kD).)

Western Blot (WB)

(Western Blot analysis of SERPINB3 expression in transfected 293T cell line by SERPINB3 monoclonal antibody. Lane 1: SERPINB3 transfected lysate (44.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SERPINB3 expression in transfected 293T cell line by SERPINB3 monoclonal antibody. Lane 1: SERPINB3 transfected lysate (44.6kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of SERPINB3 transfected lysate using SERPINB3 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SERPINB3 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SERPINB3 transfected lysate using SERPINB3 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SERPINB3 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SERPINB3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SERPINB3 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-SERPINB3 antibody
May act as a protease inhibitor to modulate the host immune response against tumor cells.
Product Categories/Family for anti-SERPINB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47kDa (413aa) confirmed by MALDI-TOF
NCBI Official Full Name
serpin B3
NCBI Official Synonym Full Names
serpin family B member 3
NCBI Official Symbol
SERPINB3
NCBI Official Synonym Symbols
SCC; T4-A; SCCA1; SSCA1; SCCA-1; HsT1196; SCCA-PD
NCBI Protein Information
serpin B3
UniProt Protein Name
Serpin B3
Protein Family
UniProt Gene Name
SERPINB3
UniProt Synonym Gene Names
SCCA; SCCA1; SCCA-1
UniProt Entry Name
SPB3_HUMAN

Uniprot Description

SERPINB3: May act as a protease inhibitor to modulate the host immune response against tumor cells. Belongs to the serpin family. Ov-serpin subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 18q21.3

Cellular Component: cytoplasm; cytoplasmic vesicle; extracellular space; nucleus; vesicle

Molecular Function: cysteine protease inhibitor activity; protease binding; serine-type endopeptidase inhibitor activity; viral receptor activity

Biological Process: negative regulation of catalytic activity; negative regulation of JNK activity; negative regulation of peptidase activity; negative regulation of proteolysis; positive regulation of cell migration; positive regulation of cell proliferation

Research Articles on SERPINB3

Similar Products

Product Notes

The SERPINB3 serpinb3 (Catalog #AAA6138991) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SERPINB3 (Serpin B3, Protein T4-A, Squamous Cell Carcinoma Antigen 1, SCCA-1, SCCA, SCCA1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINB3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SERPINB3 serpinb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SERPINB3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.