Testing Data
(Detection limit for recombinant GST tagged SERGEF is 1ng/ml as a capture antibody.)
Mouse anti-Human SERGEF Monoclonal Antibody | anti-SERGEF antibody
SERGEF (Secretion-regulating Guanine Nucleotide Exchange Factor, Deafness Locus-associated Putative Guanine Nucleotide Exchange Factor, DelGEF, Guanine Nucleotide Exchange Factor-related Protein, DELGEF, GNEFR) APC
Gene Names
SERGEF; Gnefr; DELGEF
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SERGEF; Monoclonal Antibody; SERGEF (Secretion-regulating Guanine Nucleotide Exchange Factor; Deafness Locus-associated Putative Guanine Nucleotide Exchange Factor; DelGEF; Guanine Nucleotide Exchange Factor-related Protein; DELGEF; GNEFR) APC; anti-SERGEF antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A2
Specificity
Recognizes human DELGEF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SERGEF antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa240-338 from human DELGEF (NP_036271) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KHGQLANEAAFLPVPQKIEAHCFQNEKVTAIWSGWTHLVAQTETGKMFTWGRADYGQLGRKLETYEGWKLEKQDSFLPCSRPPNSMPSSPHCLTGATE*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged SERGEF is 1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SERGEF is 1ng/ml as a capture antibody.)
Related Product Information for anti-SERGEF antibody
Probable guanine nucleotide exchange factor (GEF), which may be involved in the secretion process.
Product Categories/Family for anti-SERGEF antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,566 Da
NCBI Official Full Name
secretion-regulating guanine nucleotide exchange factor
NCBI Official Synonym Full Names
secretion regulating guanine nucleotide exchange factor
NCBI Official Symbol
SERGEF
NCBI Official Synonym Symbols
Gnefr; DELGEF
NCBI Protein Information
secretion-regulating guanine nucleotide exchange factor; deafness locus associated putative guanine nucleotide exchange factor; deafness locus-associated putative guanine nucleotide exchange factor; guanine nucleotide exchange factor-related protein
UniProt Protein Name
Secretion-regulating guanine nucleotide exchange factor
Protein Family
UniProt Gene Name
SERGEF
UniProt Synonym Gene Names
DELGEF; GNEFR; DelGEF
UniProt Entry Name
SRGEF_HUMAN
Uniprot Description
SERGEF: Probable guanine nucleotide exchange factor (GEF), which may be involved in the secretion process. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: GEFs; GEFs, Ras
Chromosomal Location of Human Ortholog: 11p14.3
Cellular Component: intermediate filament cytoskeleton; cytoplasm; nucleolus; nucleus
Molecular Function: protein binding; Ran guanyl-nucleotide exchange factor activity
Biological Process: negative regulation of protein secretion; signal transduction
Similar Products
Product Notes
The SERGEF sergef (Catalog #AAA6138984) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SERGEF (Secretion-regulating Guanine Nucleotide Exchange Factor, Deafness Locus-associated Putative Guanine Nucleotide Exchange Factor, DelGEF, Guanine Nucleotide Exchange Factor-related Protein, DELGEF, GNEFR) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERGEF can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SERGEF sergef for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SERGEF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
