Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human SEC63 Monoclonal Antibody | anti-SEC63 antibody

SEC63 (Translocation Protein SEC63 Homolog, SEC63L, DNAJC23, ERdj2, PRO2507) (Biotin)

Gene Names
SEC63; ERdj2; PCLD2; SEC63L; DNAJC23; PRO2507
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SEC63; Monoclonal Antibody; SEC63 (Translocation Protein SEC63 Homolog; SEC63L; DNAJC23; ERdj2; PRO2507) (Biotin); anti-SEC63 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A8
Specificity
Recognizes human SEC63.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
6430
Applicable Applications for anti-SEC63 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa631-729 from SEC63 (NP_009145) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KSKITHPVYSLYFPEEKQEWWWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAKPVPENHPQ*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Testing Data

(Detection limit for recombinant GST tagged SEC63 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SEC63 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-SEC63 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens SEC63 homolog, protein translocation regulator (SEC63), mRNA
NCBI Official Synonym Full Names
SEC63 homolog, protein translocation regulator
NCBI Official Symbol
SEC63
NCBI Official Synonym Symbols
ERdj2; PCLD2; SEC63L; DNAJC23; PRO2507
NCBI Protein Information
translocation protein SEC63 homolog
UniProt Protein Name
Translocation protein SEC63 homolog
Protein Family
UniProt Gene Name
SEC63
UniProt Synonym Gene Names
SEC63L
UniProt Entry Name
SEC63_HUMAN

NCBI Description

The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER. [provided by RefSeq, Jul 2008]

Uniprot Description

SEC63: Required for integral membrane and secreted preprotein translocation across the endoplasmic reticulum membrane. Defects in SEC63 are a cause of polycystic liver disease (PCLD). PCLD is an autosomal dominant disorder and is characterized by the presence of multiple liver cysts of biliary epithelial origin.

Protein type: Membrane protein, multi-pass; Endoplasmic reticulum; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6q21

Cellular Component: endoplasmic reticulum membrane; membrane; endoplasmic reticulum; integral to membrane

Molecular Function: protein binding; receptor activity; protein transporter activity

Biological Process: SRP-dependent cotranslational protein targeting to membrane; posttranslational protein targeting to membrane, translocation; nitrogen compound metabolic process; multicellular organismal aging; posttranslational protein targeting to membrane; liver development; protein targeting to membrane

Disease: Polycystic Liver Disease

Research Articles on SEC63

Similar Products

Product Notes

The SEC63 sec63 (Catalog #AAA6144260) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SEC63 (Translocation Protein SEC63 Homolog, SEC63L, DNAJC23, ERdj2, PRO2507) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SEC63 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEC63 sec63 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SEC63, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.