Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (estern Blot detection against Immunogen (37kD).)

Mouse anti-Human SEC14L2 Monoclonal Antibody | anti-SEC14L2 antibody

SEC14L2 (SEC14-like Protein 2, Alpha-tocopherol-associated Protein, TAP, hTAP, TAP1, C22orf6, KIAA1186, KIAA1658, Squalene Transfer Protein, Supernatant Protein Factor, SPF) (AP)

Gene Names
SEC14L2; SPF; TAP; TAP1; C22orf6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SEC14L2; Monoclonal Antibody; SEC14L2 (SEC14-like Protein 2; Alpha-tocopherol-associated Protein; TAP; hTAP; TAP1; C22orf6; KIAA1186; KIAA1658; Squalene Transfer Protein; Supernatant Protein Factor; SPF) (AP); anti-SEC14L2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E5
Specificity
Recognizes human SEC14L2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
4207
Applicable Applications for anti-SEC14L2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa101-200 from SEC14L2 (NP_036561) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFP*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(estern Blot detection against Immunogen (37kD).)

Western Blot (WB) (estern Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged SEC14L2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SEC14L2 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SEC14L2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens SEC14 like lipid binding 2 (SEC14L2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
SEC14 like lipid binding 2
NCBI Official Symbol
SEC14L2
NCBI Official Synonym Symbols
SPF; TAP; TAP1; C22orf6
NCBI Protein Information
SEC14-like protein 2
UniProt Protein Name
SEC14-like protein 2
Protein Family
UniProt Gene Name
SEC14L2
UniProt Synonym Gene Names
C22orf6; KIAA1186; KIAA1658; TAP; hTAP; SPF
UniProt Entry Name
S14L2_HUMAN

NCBI Description

This gene encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

SEC14L2: Carrier protein. Binds to some hydrophobic molecules and promotes their transfer between the different cellular sites. Binds with high affinity to alpha-tocopherol. Also binds with a weaker affinity to other tocopherols and to tocotrienols. May have a transcriptional activatory activity via its association with alpha-tocopherol. Probably recognizes and binds some squalene structure, suggesting that it may regulate cholesterol biosynthesis by increasing the transfer of squalene to a metabolic active pool in the cell. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: cytoplasm; integral to membrane; nucleus

Molecular Function: transporter activity; phospholipid binding; vitamin E binding

Biological Process: transcription, DNA-dependent; transport; regulation of cholesterol biosynthetic process; positive regulation of transcription, DNA-dependent

Research Articles on SEC14L2

Similar Products

Product Notes

The SEC14L2 sec14l2 (Catalog #AAA6133651) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SEC14L2 (SEC14-like Protein 2, Alpha-tocopherol-associated Protein, TAP, hTAP, TAP1, C22orf6, KIAA1186, KIAA1658, Squalene Transfer Protein, Supernatant Protein Factor, SPF) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SEC14L2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEC14L2 sec14l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SEC14L2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.