Mouse anti-Human SCUBE3 Monoclonal Antibody | anti-SCUBE3 antibody

SCUBE3 (Signal Peptide, CUB and EGF-like Domain-containing Protein 3, CEGF3) APC

Cat. Num. AAA6138943

• Gene Names: SCUBE3; CEGF3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SCUBE3; Monoclonal Antibody; SCUBE3 (Signal Peptide; CUB and EGF-like Domain-containing Protein 3; CEGF3) APC; anti-SCUBE3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D6
• Specificity: Recognizes human SCUBE3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-SCUBE3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa29-148 from human SCUBE3 (AAH52263) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGSYECHCREGFFLSDN
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (39.2kD).)

Testing Data

(Detection limit for recombinant GST tagged SCUBE3 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-SCUBE3 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 30353968
• NCBI GeneID: 222663
• Molecular Weight: 111,099 Da
• NCBI Official Full Name: Homo sapiens signal peptide, CUB domain, EGF-like 3, mRNA
• NCBI Official Synonym Full Names: signal peptide, CUB domain and EGF like domain containing 3
• NCBI Official Symbol: SCUBE3
• NCBI Official Synonym Symbols: CEGF3
• NCBI Protein Information: signal peptide, CUB and EGF-like domain-containing protein 3
• Protein Family: Signal peptide, CUB and EGF-like domain-containing protein

NCBI Description

This gene encodes a member of the signal peptide, complement subcomponents C1r/C1s, Uegf, bone morphogenetic protein-1 and epidermal growth factor-like domain containing protein family. Overexpression of this gene in human embryonic kidney cells results in secretion of a glycosylated form of the protein that forms oligomers and tethers to the cell surface. This gene is upregulated in lung cancer tumor tissue compared to healthy tissue and is associated with loss of the epithelial marker E-cadherin and with increased expression of vimentin, a mesenchymal marker. In addition, the protein encoded by this gene is a transforming growth factor beta receptor ligand, and when secreted by cancer cells, it can be cleaved in vitro to release the N-terminal epidermal growth factor-like repeat domain and the C-terminal complement subcomponents C1r/C1s domain. Both the full length protein and C-terminal fragment can bind to the transforming growth factor beta type II receptor to promote the epithelial-mesenchymal transition and tumor angiogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]