Western Blot (WB)
(Western Blot detection against Immunogen (51.41kD).)
Mouse anti-Human SCNM1 Monoclonal Antibody | anti-SCNM1 antibody
SCNM1 (Sodium Channel Modifier 1)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
SCNM1; Monoclonal Antibody; SCNM1 (Sodium Channel Modifier 1); Anti -SCNM1 (Sodium Channel Modifier 1); anti-SCNM1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E10
Specificity
Recognizes human SCNM1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLSSLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPSVSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWVKDENVEFDSDEEEPPDLPLD
Applicable Applications for anti-SCNM1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-231 from human SCNM1 (AAH00264) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (51.41kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (51.41kD).)
Western Blot (WB)
(SCNM1 monoclonal antibody. Western Blot analysis of SCNM1 expression in human colon.)
Western Blot (WB)
(SCNM1 monoclonal antibody. Western Blot analysis of SCNM1 expression in human colon.)
Testing Data
(Detection limit for recombinant GST tagged SCNM1 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged SCNM1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-SCNM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,949 Da
NCBI Official Full Name
sodium channel modifier 1 isoform 2
NCBI Official Synonym Full Names
sodium channel modifier 1
NCBI Official Symbol
SCNM1
NCBI Protein Information
sodium channel modifier 1
UniProt Protein Name
Sodium channel modifier 1
Protein Family
UniProt Gene Name
SCNM1
UniProt Entry Name
SCNM1_HUMAN
NCBI Description
SCNM1 is a zinc finger protein and putative splicing factor. In mice, Scnm1 modifies phenotypic expression of Scn8a (MIM 600702) mutations (Buchner et al., 2003 [PubMed 12920299]).[supplied by OMIM, Oct 2009]
Uniprot Description
Function: Plays a role in RNA splicing, possibly contributing to the recognition of non-consensus donor sites
By similarity.
Subunit structure: Interacts with LUC7L2 and SNRNP70, which suggests a role as a spliceosome component
By similarity.
Subcellular location: Nucleus
By similarity. Nucleus speckle
By similarity. Note: Colocalizes with LUC7L2 and SNRNP70 in nuclear speckles
By similarity.
Sequence similarities: Contains 1 matrin-type zinc finger.
Similar Products
Product Notes
The SCNM1 scnm1 (Catalog #AAA647531) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCNM1 (Sodium Channel Modifier 1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCNM1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SCNM1 scnm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSFKREGDDW SQLNVLKKRR VGDLLASYIP EDEALMLRDG RFACAICPHR PVLDTLAMLT AHRAGKKHLS SLQLFYGKKQ PGKERKQNPK HQNELRREET KAEAPLLTQT RLITQSALHR APHYNSCCRR KYRPEAPGPS VSLSPMPPSE VKLQSGKISR EPEPAAGPQA EESATVSAPA PMSPTRRRAL DHYLTLRSSG WIPDGRGRWV KDENVEFDSD EEEPPDLPLD. It is sometimes possible for the material contained within the vial of "SCNM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
