Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human, Mouse SCN8A Monoclonal Antibody | anti-SCN8A antibody

SCN8A (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.6, MED) (FITC)

Gene Names
SCN8A; MED; PN4; CIAT; BFIS5; NaCh6; CERIII; EIEE13; Nav1.6
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SCN8A; Monoclonal Antibody; SCN8A (Sodium Channel Protein Type 8 Subunit alpha; Sodium Channel Protein Type VIII Subunit alpha; Voltage-gated Sodium Channel Subunit alpha Nav1.6; MED) (FITC); anti-SCN8A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G7
Specificity
Recognizes human SCN8A. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SCN8A antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1854-1952 from human SCN8A (NP_055006) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(SCN8A monoclonal antibody, Western Blot analysis of SCN8A expression in NIH/3T3.)

Western Blot (WB) (SCN8A monoclonal antibody, Western Blot analysis of SCN8A expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SCN8A on NIH/3T3 cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SCN8A on NIH/3T3 cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-SCN8A antibody
References
1. Na(v)1. 1 localizes to axons of parvalbumin-positive inhibitory interneurons: a circuit basis for epileptic seizures in mice carrying an Scn1a gene mutation. Ogiwara I, Miyamoto H, Morita N, Atapour N, Mazaki E, Inoue I, Takeuchi T, Itohara S, Yanagawa Y, Obata K, Furuichi T, Hensch TK, Yamakawa K.J Neurosci. 2007 May 30;27(22):5903-14.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
225kDa
NCBI Official Full Name
sodium channel protein type 8 subunit alpha isoform 1
NCBI Official Synonym Full Names
sodium voltage-gated channel alpha subunit 8
NCBI Official Symbol
SCN8A
NCBI Official Synonym Symbols
MED; PN4; CIAT; BFIS5; NaCh6; CERIII; EIEE13; Nav1.6
NCBI Protein Information
sodium channel protein type 8 subunit alpha
UniProt Protein Name
Sodium channel protein type 8 subunit alpha
Protein Family
UniProt Gene Name
SCN8A
UniProt Synonym Gene Names
MED
UniProt Entry Name
SCN8A_HUMAN

NCBI Description

This gene encodes a member of the sodium channel alpha subunit gene family. The encoded protein forms the ion pore region of the voltage-gated sodium channel. This protein is essential for the rapid membrane depolarization that occurs during the formation of the action potential in excitable neurons. Mutations in this gene are associated with cognitive disability, pancerebellar atrophy and ataxia. Alternate splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

SCN8A: Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. In macrophages and melanoma cells, isoform 5 may participate in the control of podosome and invadopodia formation. Defects in SCN8A are the cause of cognitive impairment with or without cerebellar ataxia (CIAT). A disorder characterized by markedly delayed cognitive and motor development, attention deficit disorder, and cerebellar ataxia. Features include bilateral esophoria, strabismatic amblyopia, unsustained gaze evoked nystagmus on horizontal gaze, ataxic gait, dysmetria in the upper limbs and dysarthria, with normal strength, tone, and reflexes. Defects in SCN8A are the cause of epileptic encephalopathy, early infantile, type 13 (EIEE13). A form of epilepsy characterized by frequent tonic seizures or spasms beginning in infancy with a specific EEG finding of suppression-burst patterns, characterized by high-voltage bursts alternating with almost flat suppression phases. Patients may progress to West syndrome, which is characterized by tonic spasms with clustering, arrest of psychomotor development, and hypsarrhythmia on EEG. EIEE13 is a severe form consisting of early-onset seizures, features of autism, intellectual disability, ataxia, and sudden unexplained death in epilepsy. Belongs to the sodium channel (TC 1.A.1.10) family. Nav1.6/SCN8A subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, sodium; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: voltage-gated sodium channel complex; cell soma; cytoplasmic membrane-bound vesicle; dendrite; integral to membrane; plasma membrane; Z disc

Molecular Function: voltage-gated sodium channel activity; ATP binding

Biological Process: myelination; nervous system development; muscle development; sensory perception of sound; response to toxin; neuromuscular process; sodium ion transport; generation of action potential; adult walking behavior; peripheral nervous system development

Disease: Epileptic Encephalopathy, Early Infantile, 13; Cognitive Impairment With Or Without Cerebellar Ataxia

Research Articles on SCN8A

Similar Products

Product Notes

The SCN8A scn8a (Catalog #AAA6149541) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCN8A (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.6, MED) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SCN8A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCN8A scn8a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCN8A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.