Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.35kD).)

Mouse anti-Human SAV1 Monoclonal Antibody | anti-SAV1 antibody

SAV1 (Protein Salvador Homolog 1, SAV, 45kD WW Domain Protein, WW45, hWW45, WWP4) (AP)

Gene Names
SAV1; SAV; WW45; WWP4
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SAV1; Monoclonal Antibody; SAV1 (Protein Salvador Homolog 1; SAV; 45kD WW Domain Protein; WW45; hWW45; WWP4) (AP); anti-SAV1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B2
Specificity
Recognizes human SAV1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
383
Applicable Applications for anti-SAV1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa300-384 from human SAV1 (NP_068590) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQQHGKNF
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.35kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.35kD).)

Western Blot (WB)

(SAV1 monoclonal antibody. Western Blot analysis of SAV1 expression in HepG2.)

Western Blot (WB) (SAV1 monoclonal antibody. Western Blot analysis of SAV1 expression in HepG2.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SAV1 on HeLa cell. [antibody concentration 60ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SAV1 on HeLa cell. [antibody concentration 60ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of SAV1 transfected lysate using SAV1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SAV1 transfected lysate using SAV1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged SAV1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SAV1 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(SAV1 monoclonal antibody (M02), Western Blot analysis of SAV1 expression in Hela NE.)

Western Blot (WB) (SAV1 monoclonal antibody (M02), Western Blot analysis of SAV1 expression in Hela NE.)
Product Categories/Family for anti-SAV1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein salvador homolog 1
NCBI Official Synonym Full Names
salvador family WW domain containing protein 1
NCBI Official Symbol
SAV1
NCBI Official Synonym Symbols
SAV; WW45; WWP4
NCBI Protein Information
protein salvador homolog 1
UniProt Protein Name
Protein salvador homolog 1
Protein Family
UniProt Gene Name
SAV1
UniProt Synonym Gene Names
WW45; hWW45
UniProt Entry Name
SAV1_HUMAN

NCBI Description

WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein with two WW domains, a SARAH domain, and a coiled-coil region and is ubiquitously expressed in adult tissues. This protein binds to MST1 (mammalian sterile 20-like kinase 1) and promotes MST1-induced apoptosis. It has also been shown to bind to HAX1 (hematopoietic cell-specific protein 1 (HS1)-associated protein X-1) and to attenuate the anti-apoptotic effects of HAX1. Studies in human and mouse suggest this gene acts as a tumor suppressor. [provided by RefSeq, Aug 2012]

Uniprot Description

SAV1: Regulator of STK3/MST2 and STK4/MST1 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. SAV1 is required for STK3/MST2 and STK4/MST1 activation and promotes cell-cycle exit and terminal differentiation in developing epithelial tissues. Plays a role in centrosome disjunction by regulating the localization of NEK2 to centrosomes, and its ability to phosphorylate CROCC and CEP250. In conjunction with STK3/MST2, activates the transcriptional activity of ESR1 through the modulation of its phosphorylation. Homodimer. Stabilized through interaction with STK3/MST2 or STK4/MST1. Interacts (via SARAH domain) with isoform 1 of NEK2. Interacts with ESR1 only in the presence of STK3/MST2. Interacts with WTIP and AJUBA. Ubiquitously expressed in adult tissues with highest expression in the pancreas, aorta and interventricular septum and lowest expression in skeletal muscle. Expression was higher in fetal than in the adult heart. Expressed in various cell lines.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 14q13-q23

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: protein binding

Biological Process: hair follicle development; keratinocyte differentiation; negative regulation of cardiac muscle cell proliferation; negative regulation of epithelial cell proliferation; positive regulation of apoptosis; positive regulation of fat cell differentiation

Research Articles on SAV1

Similar Products

Product Notes

The SAV1 sav1 (Catalog #AAA6133610) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SAV1 (Protein Salvador Homolog 1, SAV, 45kD WW Domain Protein, WW45, hWW45, WWP4) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SAV1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SAV1 sav1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SAV1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.