Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human, Mouse SALL4 Monoclonal Antibody | anti-SALL4 antibody

SALL4 (Sal-like Protein 4, HSAL4, dJ1112F19.1, DRRS, Zinc Finger Protein 797, ZNF797, Zinc Finger Protein SALL4) (Biotin)

Gene Names
SALL4; DRRS; HSAL4; ZNF797; dJ1112F19.1
Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SALL4; Monoclonal Antibody; SALL4 (Sal-like Protein 4; HSAL4; dJ1112F19.1; DRRS; Zinc Finger Protein 797; ZNF797; Zinc Finger Protein SALL4) (Biotin); anti-SALL4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6E3
Specificity
Recognizes human SALL4. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SALL4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.2ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa954-1054 from human SALL4 (NP_065169) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(SALL4 monoclonal antibody, Western Blot analysis of SALL4 expression in Hela NE.)

Western Blot (WB) (SALL4 monoclonal antibody, Western Blot analysis of SALL4 expression in Hela NE.)

Western Blot (WB)

(SALL4 monoclonal antibody. Western Blot analysis of SALL4 expression in NIH/3T3.)

Western Blot (WB) (SALL4 monoclonal antibody. Western Blot analysis of SALL4 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SALL4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.2ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SALL4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.2ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SALL4 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SALL4 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-SALL4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65,708 Da
NCBI Official Full Name
sal-like protein 4
NCBI Official Synonym Full Names
spalt-like transcription factor 4
NCBI Official Symbol
SALL4
NCBI Official Synonym Symbols
DRRS; HSAL4; ZNF797; dJ1112F19.1
NCBI Protein Information
sal-like protein 4; zinc finger protein 797; zinc finger protein SALL4
UniProt Protein Name
Sal-like protein 4
Protein Family
UniProt Gene Name
SALL4
UniProt Synonym Gene Names
ZNF797
UniProt Entry Name
SALL4_HUMAN

Uniprot Description

SALL4: a transcription factor and oncofetal protein expressed embryonically and in the testis. Plays a key role in maintenance and self-renewal of embryonic stem cells. Interacts with NANOG and OCT4. Ectopically expressed in acute B-cell lymphoblastic leukemia (B-ALL) and myeloid leukemia (AML), playing a role in the survival of B-ALL cells and in myeloid leukemogenesis. Aberrantly expressed in multiple carcinomas including human gastric carcinoma and hepatocellular carcinoma. Maintains the stem cell qualities of EpCAM-positive hepatocellular carcinoma cells. Expressed in primary human endometrial cancer samples but not normal or hyperplastic endometrial cells. Its expression in carcinomas positively correlates with metastatic potential and poor patient survival. Specifically binds the c-Myc promoter region in endometrial cancer cells, apparently increasing c-Myc expression. Belongs to the sal C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA); DNA-binding; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: nucleoplasm; heterochromatin; protein complex; intracellular membrane-bound organelle; cytoplasm

Molecular Function: DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; somatic stem cell maintenance; neural tube closure; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; inner cell mass cell proliferation; embryonic limb morphogenesis

Disease: Ivic Syndrome; Duane-radial Ray Syndrome

Similar Products

Product Notes

The SALL4 sall4 (Catalog #AAA6144206) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SALL4 (Sal-like Protein 4, HSAL4, dJ1112F19.1, DRRS, Zinc Finger Protein 797, ZNF797, Zinc Finger Protein SALL4) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SALL4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.2ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SALL4 sall4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SALL4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.