Mouse anti-Human SAE1 Monoclonal Antibody | anti-SAE1 antibody

SAE1 (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A) (Biotin)

Cat. Num. AAA6144201

• Gene Names: SAE1; AOS1; SUA1; UBLE1A; HSPC140
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SAE1; Monoclonal Antibody; SAE1 (SUMO-activating Enzyme Subunit 1; Ubiquitin-like 1-activating Enzyme E1A; AOS1; SUA1; UBLE1A) (Biotin); anti-SAE1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1, lambda
• Clone Number: 1G4-1G5
• Specificity: Recognizes human SAE1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SAE1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-346 from SAE1 (AAH00344) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (63.8kD).)

Western Blot (WB)

(SAE1 monoclonal antibody Western Blot analysis of SAE1 expression in HeLa)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SAE1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SAE1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SAE1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-SAE1 antibody

Antibodies; Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 33875334
• NCBI GeneID: 10055
• Molecular Weight: 33,063 Da
• NCBI Official Full Name: Homo sapiens SUMO1 activating enzyme subunit 1, mRNA
• NCBI Official Synonym Full Names: SUMO1 activating enzyme subunit 1
• NCBI Official Symbol: SAE1
• NCBI Official Synonym Symbols: AOS1; SUA1; UBLE1A; HSPC140
• NCBI Protein Information: SUMO-activating enzyme subunit 1
• Protein Family: SUMO-activating enzyme

NCBI Description

Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).[supplied by OMIM, Mar 2010]