Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Mouse anti-Human S100A10 Monoclonal Antibody | anti-S100A10 antibody

S100A10 (Protein S100-A10, Calpactin I Light Chain, Calpactin-1 Light Chain, Cellular Ligand of Annexin II, S100 Calcium-binding Protein A10, p10 Protein, p11, ANX2LG, CAL1L, CLP11, MGC111133) (HRP)

Gene Names
S100A10; 42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
S100A10; Monoclonal Antibody; S100A10 (Protein S100-A10; Calpactin I Light Chain; Calpactin-1 Light Chain; Cellular Ligand of Annexin II; S100 Calcium-binding Protein A10; p10 Protein; p11; ANX2LG; CAL1L; CLP11; MGC111133) (HRP); anti-S100A10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D2-F1
Specificity
Recognizes human S100A10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-S100A10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-98 from human S100A10 (AAH15973) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.78kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to S100A10 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to S100A10 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged S100A10 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged S100A10 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-S100A10 antibody
S100A10/p11 belongs to the S-100 calcium binding protein family, although it has had crucial aa substitutions and deletions that render it incapable of binding calcium. p11 forms a heterotetrameric complex with annexin II. p11 functions as an auxiliary protein and has been shown to interact directly the potassium channel TASK-1. It is essential for TASK1 trafficking to the plasma membrane. p11 also increases the localization of 5HT1B receptors to the cell surface.
Product Categories/Family for anti-S100A10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
11,203 Da
NCBI Official Full Name
Homo sapiens S100 calcium binding protein A10, mRNA
NCBI Official Synonym Full Names
S100 calcium binding protein A10
NCBI Official Symbol
S100A10
NCBI Official Synonym Symbols
42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG
NCBI Protein Information
protein S100-A10
Protein Family

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis. [provided by RefSeq, Jul 2008]

Research Articles on S100A10

Similar Products

Product Notes

The S100A10 (Catalog #AAA6154794) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The S100A10 (Protein S100-A10, Calpactin I Light Chain, Calpactin-1 Light Chain, Cellular Ligand of Annexin II, S100 Calcium-binding Protein A10, p10 Protein, p11, ANX2LG, CAL1L, CLP11, MGC111133) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's S100A10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the S100A10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "S100A10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.