Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RUNX2 Monoclonal Antibody | anti-RUNX2 antibody

RUNX2 (Runt-related Transcription Factor 2, Core-binding Factor Subunit alpha-1, CBF-alpha-1, Acute Myeloid Leukemia 3 Protein, Oncogene AML-3, Polyomavirus Enhancer-binding Protein 2 alpha A Subunit, PEBP2-alpha A, PEA2-alpha A, SL3-3 Enhancer Factor 1 a

Gene Names
RUNX2; CCD; AML3; CCD1; CLCD; OSF2; CBFA1; OSF-2; PEA2aA; PEBP2aA; CBF-alpha-1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RUNX2; Monoclonal Antibody; RUNX2 (Runt-related Transcription Factor 2; Core-binding Factor Subunit alpha-1; CBF-alpha-1; Acute Myeloid Leukemia 3 Protein; Oncogene AML-3; Polyomavirus Enhancer-binding Protein 2 alpha A Subunit; PEBP2-alpha A; PEA2-alpha A; SL3-3 Enhancer Factor 1 a; anti-RUNX2 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b
Clone Number
1D8
Specificity
Recognizes human RUNX2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RUNX2 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa251-350 from human RUNX2 (NP_004339) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-RUNX2 antibody
References
1. Runt-related transcription factor 2 (RUNX2) in human colon carcinoma: A potent prognostic factor associated with estrogen receptor. Sase T, Suzuki T, Miura K, Shiiba K, Sato I, Nakamura Y, Takagi K, Onodera Y, Miki Y, Watanabe M, Ishida K, Ohnuma S, Sasaki H, Sato R, Karasawa H, Shibata C, Unno M, Sasaki I, Sasano H.Int J Cancer. 2012 Mar 7. doi: 10.1002/ijc.27525.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
860
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
Runt-related transcription factor 2
NCBI Official Synonym Full Names
runt related transcription factor 2
NCBI Official Symbol
RUNX2
NCBI Official Synonym Symbols
CCD; AML3; CCD1; CLCD; OSF2; CBFA1; OSF-2; PEA2aA; PEBP2aA; CBF-alpha-1
NCBI Protein Information
runt-related transcription factor 2
UniProt Protein Name
Runt-related transcription factor 2
UniProt Gene Name
RUNX2
UniProt Synonym Gene Names
AML3; CBFA1; OSF2; PEBP2A; CBF-alpha-1; OSF-2; PEA2-alpha A; PEBP2-alpha A
UniProt Entry Name
RUNX2_HUMAN

Similar Products

Product Notes

The RUNX2 runx2 (Catalog #AAA24349) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RUNX2 (Runt-related Transcription Factor 2, Core-binding Factor Subunit alpha-1, CBF-alpha-1, Acute Myeloid Leukemia 3 Protein, Oncogene AML-3, Polyomavirus Enhancer-binding Protein 2 alpha A Subunit, PEBP2-alpha A, PEA2-alpha A, SL3-3 Enhancer Factor 1 a reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RUNX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RUNX2 runx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RUNX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.