Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human, Rat RSK4 Monoclonal Antibody | anti-RSK4 antibody

RSK4 (RPS6KA6, RSK4, Ribosomal Protein S6 Kinase alpha-6, 90kD Ribosomal Protein S6 Kinase 6, Ribosomal S6 Kinase 4, pp90RSK4) (PE)

Gene Names
RPS6KA6; RSK4; RSK-4; p90RSK6; PP90RSK4; S6K-alpha-6
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RSK4; Monoclonal Antibody; RSK4 (RPS6KA6; Ribosomal Protein S6 Kinase alpha-6; 90kD Ribosomal Protein S6 Kinase 6; Ribosomal S6 Kinase 4; pp90RSK4) (PE); anti-RSK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6F2
Specificity
Recognizes human RPS6KA6. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
8465
Applicable Applications for anti-RSK4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa636-746 from human RPS6KA6 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(RPS6KA6 monoclonal antibody. Western Blot analysis of RPS6KA6 expression in PC-12.)

Western Blot (WB) (RPS6KA6 monoclonal antibody. Western Blot analysis of RPS6KA6 expression in PC-12.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RPS6KA6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RPS6KA6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])
Product Categories/Family for anti-RSK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ribosomal protein S6 kinase A6 (RPS6KA6), transcript variant 2, mRNA
NCBI Official Synonym Full Names
ribosomal protein S6 kinase A6
NCBI Official Symbol
RPS6KA6
NCBI Official Synonym Symbols
RSK4; RSK-4; p90RSK6; PP90RSK4; S6K-alpha-6
NCBI Protein Information
ribosomal protein S6 kinase alpha-6
UniProt Protein Name
Ribosomal protein S6 kinase alpha-6
UniProt Gene Name
RPS6KA6
UniProt Synonym Gene Names
RSK4; S6K-alpha-6; p90-RSK 6; p90RSK6; RSK-4
UniProt Entry Name
KS6A6_HUMAN

NCBI Description

This gene encodes a member of ribosomal S6 kinase family, serine-threonine protein kinases which are regulated by growth factors. The encoded protein may be distinct from other members of this family, however, as studies suggest it is not growth factor dependent and may not participate in the same signaling pathways. [provided by RefSeq, Jan 2010]

Uniprot Description

RSK4: an AGC kinase of the RSK family. Phosphorylates a wide range of substrates including ribosomal protein S6. Implicated in the activation of the mitogen- activated kinase cascade. May play a role in normal neuronal development.

Protein type: Protein kinase, AGC; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; AGC group; RSK family; RSK subfamily

Chromosomal Location of Human Ortholog: Xq21

Cellular Component: nucleoplasm; mitochondrion; nucleolus; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; magnesium ion binding; ATP binding; protein kinase activity

Biological Process: axon guidance; synaptic transmission; negative regulation of embryonic development; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; central nervous system development; signal transduction; protein amino acid phosphorylation

Research Articles on RSK4

Similar Products

Product Notes

The RSK4 rps6ka6 (Catalog #AAA6160077) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RSK4 (RPS6KA6, RSK4, Ribosomal Protein S6 Kinase alpha-6, 90kD Ribosomal Protein S6 Kinase 6, Ribosomal S6 Kinase 4, pp90RSK4) (PE) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RSK4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RSK4 rps6ka6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RSK4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.